KEGG   Xiphophorus couchianus (Monterrey platyfish): 114160192Help
Entry
114160192         CDS       T05908                                 

Definition
(RefSeq) nucleoside diphosphate kinase A-like isoform X1
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00230  Purine metabolism
xco00240  Pyrimidine metabolism
xco00983  Drug metabolism - other enzymes
xco01100  Metabolic pathways
Module
xco_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
xco_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
xco_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114160192
   00240 Pyrimidine metabolism
    114160192
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    114160192
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114160192
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     114160192
Membrane trafficking [BR:xco04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    114160192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 114160192
NCBI-ProteinID: XP_027898458
Position
16
AA seq 226 aa AA seqDB search
MTGEFLMGRVDFTPGADKTRVKRTVMLQRRVFHAALKHFFTGTQETKRTLPCGLLCAQRW
GHNLVLHRRKSSLPDVRERTLIAIKPDGVQRRLVGQIIQRFEQRGFKLVGLKMLQASQDV
LSEHYCNLRTKPFYGSLLRYMTSGPLVVMVWEGHNVVQTSRTMVGNTNPAEAQAGTVRGD
FSIHVSRNVVHASDSVEGAKKEIQLWFQTKDLLDWDSWDQTSTGDV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgactggcgagtttttaatggggagggttgacttcactccaggggctgacaaaacacgc
gtgaagcgcacggtcatgttgcagcgcagggttttccacgcggctcttaagcactttttc
acagggactcaagaaaccaaacgaactctgccatgtgggctcctctgtgcgcagaggtgg
ggacacaatctcgtcttgcacaggcgcaaatcaagtctcccagatgtgagggagcggact
ctcatcgccataaagccggacggagtccagcgccgccttgttggacagatcatccagcgg
ttcgagcagcgaggtttcaaattggtcgggctgaagatgctgcaggcgtctcaggatgtc
ctgtccgagcactactgcaacctgaggaccaagccgttctacggcagtctgctgcgctac
atgacctctggacccctggttgtgatggtatgggaagggcataacgtcgttcagacatca
cggactatggtgggaaacactaacccggctgaggctcaggcaggaaccgtcagaggagat
ttcagcattcatgtcagcaggaacgtggtccatgccagtgactcggtggagggggctaag
aaggagatccagctgtggtttcaaaccaaagaccttttggactgggactcctgggaccag
accagcaccggcgatgtgtga

DBGET integrated database retrieval system