KEGG   Xiphophorus couchianus (Monterrey platyfish): 114161331Help
Entry
114161331         CDS       T05908                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 1-like isoform X1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114161331
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     114161331
Protein kinases [BR:xco01001]
 Serine/threonine kinases: Other
  CAMKK family
   114161331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 114161331
NCBI-ProteinID: XP_027900352
Position
18
AA seq 488 aa AA seqDB search
MSSDNVFKPEMESDPQGELADMVASMNTTANRLTPPNGYRSGAPRSTVGQKARLTDRKMS
LQERGSRVARQPTIETKRVSITDADDCLQLNQYKLKKEIGKGSYGVVKLAYNEDSEQYYA
MKVVSKKKLIRLCGFLRRPPPQGSNSQQDLFPKFMQPLERVYREIAILKKLDHPNVVKLV
EVLDDPDEDGVHMAFELMKEGPVIEVPTDNPLTEDQARFYFRDVVLGIEYLHYHKIIHRD
IKPSNLLLGDDGHVKIADFGVSNEFEGHDALLSSTAGTPAFMAPEMMSELQQSFSGKALD
VWAMGVTLYCFVFGECPFYDEYIYSLHNKIKNKPVEFPETPSISNALRDLIERMLDKNPA
TRITIPEIKLHPWVTENGSSPLPLEEEHCKAVEVTDEEVQNSVKLIPSLSAVILVKSMLR
KRSFSNPFECQGRRAERSMSAPGGLLTGLLGLLGSSSHPSSRKISREGSREGELEDLYED
ESFIESND
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagctcggacaacgtcttcaaaccggagatggagtcggaccctcagggcgagcttgcc
gacatggtggcgtctatgaacaccaccgccaaccgcctgacccctcctaacggctacagg
tcaggagcgcccaggtctaccgtgggccaaaaggcccgcctcacagacaggaagatgtct
ctgcaggagagggggagccgcgtggcccgccagcccaccatcgagaccaaacgggtttcc
atcactgatgccgacgactgtctccagctcaaccagtataaactgaagaaagagattgga
aagggctcttatggagtggtgaaactagcctataatgaagattctgaacagtactacgca
atgaaggtagtgtcaaagaagaagctgataaggctgtgtggatttttgcgtcgcccgcct
cctcaggggtcaaactctcagcaggatctgttccccaaattcatgcagcctctggagaga
gtgtacagagagatcgccatcctcaagaagctggaccatccgaacgtagttaaactggta
gaggtgcttgatgaccctgatgaagatggagttcacatggccttcgaactaatgaaagag
gggccggtgatagaagtgcccacagacaacccgttgaccgaggaccaggctcgcttctac
ttcagagacgtcgtcctgggaatagagtacttgcactaccataagatcatccaccgagac
atcaaaccctccaatctcctgctgggggacgatggtcacgtcaagatcgcagactttggc
gtcagtaacgagtttgagggccacgacgccctcctgtccagcacggcggggacgccggcc
ttcatggctcctgagatgatgagcgagctccagcagagcttcagcggaaaggcgttggac
gtgtgggcgatgggggtcacgctgtactgctttgtcttcggggagtgcccattttatgat
gagtacatctattctttgcacaacaagatcaagaacaaacctgtggagtttccagaaacc
ccttcaataagcaatgcgttgagggatctcattgaaagaatgctggataaaaaccctgca
accagaatcaccatccctgaaataaagctccatccgtgggtgacggagaacggctccagt
cctctccctctggaggaggagcactgcaaggcggtggaggtcaccgacgaggaggtgcag
aacagcgtgaagctcatccccagcctgtccgctgtgattctggtgaagtccatgctgagg
aagcgctctttcagtaatccctttgagtgtcagggcagacgggcagagaggtccatgtct
gcccccggaggtcttcttacgggacttttgggcttactggggtcttcgtctcatccgtct
tcgaggaaaatcagcagagaagggagcagagaaggagagctggaggacttgtacgaggac
gaatccttcatcgagagcaacgattaa

DBGET integrated database retrieval system