KEGG   Xiphophorus couchianus (Monterrey platyfish): 114161475Help
Entry
114161475         CDS       T05908                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco03040  Spliceosome
xco04010  MAPK signaling pathway
xco04141  Protein processing in endoplasmic reticulum
xco04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114161475
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114161475
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114161475
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114161475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xco01009]
    114161475
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xco03041]
    114161475
   03009 Ribosome biogenesis [BR:xco03009]
    114161475
   03110 Chaperones and folding catalysts [BR:xco03110]
    114161475
   04131 Membrane trafficking [BR:xco04131]
    114161475
   03051 Proteasome [BR:xco03051]
    114161475
   03029 Mitochondrial biogenesis [BR:xco03029]
    114161475
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114161475
Protein phosphatases and associated proteins [BR:xco01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     114161475
Spliceosome [BR:xco03041]
 Complex B
  Other components
   Prp19 complex
    114161475
 Complex C
   Prp19-CDC5 complex
    114161475
Ribosome biogenesis [BR:xco03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    114161475
Chaperones and folding catalysts [BR:xco03110]
 Heat shock proteins
  HSP70 / DNAK
   114161475
Membrane trafficking [BR:xco04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    114161475
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    114161475
Proteasome [BR:xco03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    114161475
Mitochondrial biogenesis [BR:xco03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    114161475
Exosome [BR:xco04147]
 Exosomal proteins
  Proteins found in most exosomes
   114161475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR DUF1464
Motif
Other DBs
NCBI-GeneID: 114161475
NCBI-ProteinID: XP_027900578
Position
18
AA seq 637 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPNNTVFDAKRLIGRRFDDSIVQSDMKHWPFTIINDSSRPKVKVEYKGETKTFYPEEIS
SMVLLKMKEIAEAYLGKTITNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA
IAYGLDKKVGCEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLEPVEKSLRDAKMDKAQIHEIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILCGDKSEIVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVHEAETYRAEDDLQREKVVAKN
SLESYTFNMRSTIEDEKLKDKISESDKKKVLDKCNEVISWLDKNQTAEKEEFEHQQKELE
KLCNPIMTKLYQSEGQMPRAGATGTGGASGPTIEEVD
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagggaccagctgtaggcattgacctgggcactacctactcttgtgtgggagtg
tttcagcacgggaaagttgagatcattgctaatgaccaggggaacaggaccacgcccagt
tatgtggcctttactgacacagagaggctgattggagatgcagccaagaaccaggtggcc
ctcaaccccaacaacactgtttttgatgcaaagcggcttattgggcgtcgttttgacgat
agtattgtccaatcagacatgaaacattggcccttcaccatcatcaatgatagctcgagg
cccaaagtgaaagtggagtacaaaggggagacgaagaccttctacccagaggagatctcc
tccatggtgctgctgaagatgaaggagattgctgaggcataccttggcaagactataaca
aatgccgtggtgactgtacctgcctacttcaatgactctcagcgtcaggccaccaaagac
gctgggaccatttctgggctcaatgttctgcgtatcattaacgagccaacggctgctgcc
attgcttacggtttggacaaaaaggtcggatgcgagaaaaacgtcctcatcttcgacctg
ggcggcggcactttcgacgtctccatcctgaccatcgaggacggcatctttgaggtgaag
tccacggcgggcgacacccacctgggcggcgaggacttcgacaaccgcatggtgaaccac
ttcatctccgagttcaagcgcaagtacaagaaggacatcagcgacaacaagagggcggtg
cgtcgcctgcgcacggcctgcgagcgggccaagcgcacgctgtcttccagcacgcaggcc
agcatcgagatcgactccctgtacgagggcatcgacttctacacgtccatcaccagggcg
cgctttgaggagctgaacgcagacctgttccgcggaacgctggagcccgtggagaagtct
ctccgagacgccaagatggacaaggctcagatccacgagatcgtcttggtgggaggctcg
acccgcatcccaaagatccagaagctcctgcaggacttctttaacgggaaggaactcaac
aagagcattaaccctgacgaggcggtggcgtacggtgcagctgtccaggcggccatcttg
tgtggagacaaatccgagattgttcaggacctgctgctgttggacgtcacgcccttgtct
ctgggcatcgagacggcaggcggagtcatgaccgtgctgattaagaggaacaccaccatc
cccaccaagcagacccagaccttcacaacttactccgacaaccagcctggcgtgctcatt
caggtgtttgagggcgaaagggccatgaccaaagataacaacctgctcgggaaatttgag
ctgacgggaataccgccagctcctcgaggggtccctcagattgaggtgacgttcgatatc
gacgctaacggcatcatgaacgtctccgctgtcgacaagagcaccgggaaggagaacaaa
atcaccatcacaaacgacaaaggccgcttgagcaaagaggatatcgagcgcatggttcac
gaagcggagacgtacagggctgaagacgacttgcagcgagaaaaggtagtggccaagaac
agcctggagtcctacaccttcaacatgaggtccaccatagaggacgagaagctgaaggat
aagatcagcgaatcggacaagaagaaggtcctggacaaatgcaacgaggtcatcagctgg
ctcgacaaaaatcagactgcagagaaagaggagtttgagcaccagcagaaggagcttgag
aagttgtgcaacccgattatgaccaagctgtaccagagtgaaggacagatgcctagagct
ggtgcgaccggaacaggaggggcctcgggccccaccatagaggaggtcgactaa

DBGET integrated database retrieval system