KEGG   Xiphophorus couchianus (Monterrey platyfish): 114161710Help
Entry
114161710         CDS       T05908                                 

Gene name
iws1
Definition
(RefSeq) protein IWS1 homolog isoform X1
  KO
K17498  transcription factor SPN1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:xco03021]
    114161710 (iws1)
Transcription machinery [BR:xco03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     114161710 (iws1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 114161710
NCBI-ProteinID: XP_027901034
Position
18
AA seq 742 aa AA seqDB search
MDGGEEEFMSDDGGGTPVQDEHPQSDGEEMRSDGRQSEDDGSNDEDATIAMETGGAASSS
DAEDRRRADSDSEDEAPGGRRDKSGSEAEPRRHGDSDDEDSPAKRRASASDEEEEESLRK
RRQSGSEDEASSPVKRGASDNEGEEEEDVSSPAKRRGSSSEPEDAPRGDGARSNSDNVED
KPVPASSPRQHSDSDSDAEPPARRHVAPIDSDEEDEGKREEEEETGGGKWKGVMQSDSED
EEDEGQRKKAATGSDEEQREEAEKKQQRDDSEEEDDKPVKRKKVILSDSEDEDEEKEDKP
AAKRSRAVSDDDENSGSGDGSVGPDRSLAAKLRELGSDSGSDEEDRSKPAVVKKDEKALF
GSDSDSGEDDGEEKMIADIFGESGDEEEEEFTGFNQEELEADSKQPKQQQQAADESDSDE
GVDRSGQDTSFMSDFDIMLAKRKAMNSRKRRHRDGGTFISDADDVVSAMITKMNEAAEED
RTLNSQKKPALKKLTLLPQVVMHLKKQDLKETFIDSGVMSAIKEWISPLPDKSLPALRIR
EELLRILQELPNVSQETLKHSGIGRAVMFLYKHPKESRANKDLALKLINEWSRPIFGLTS
NYKGMTREERQQRDLDQQTPQRRRLSEPQKVERAQEPDVFSPPTSSGGQTPRRDLEKQLT
GEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEGDSSRGPVKKGLSRVDKQMRRFAD
IRRLTKTGHAVKISVEGNRMPL
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggacggaggagaggaggaatttatgtccgacgatgggggcgggactccggttcaggat
gagcatcctcaatccgacggcgaggagatgaggagcgacggccggcagtctgaggacgac
ggcagcaacgacgaagatgccaccattgccatggaaacaggtggagcagccagcagctcg
gacgcagaggaccggcgccgggccgacagcgactcggaggacgaggcccccgggggccgc
cgagacaagagcggctcagaggcagagcctcgtcggcacggcgacagcgacgatgaagac
tctccagcgaaacgcagggcaagtgcgtcagacgaggaagaggaggagtcgctgaggaag
agacggcagagcggctcggaggacgaggcgtcgtctccggtcaaacggggagcgtccgac
aatgagggagaggaggaggaggacgtgtcgtctcccgccaagcgccgaggaagcagctct
gagccggaggacgcccccagaggagatggcgcccgcagcaactccgacaacgtagaggac
aaaccggtgccagcatcgtctccacggcaacactccgacagtgactctgacgcagagcca
cccgccagacgccacgtggcgccgatagactctgatgaggaagatgagggtaaacgggag
gaagaggaggagaccgggggagggaagtggaagggtgtgatgcaatccgacagtgaggat
gaagaggacgaagggcagaggaagaaggctgcaacaggaagtgatgaagagcagcgcgag
gaagcagagaagaagcaacagagagatgacagcgaggaagaggacgacaaaccagtgaag
aggaagaaggtcatcttgtctgacagcgaagacgaggatgaagagaaggaagataaacca
gcggcgaagaggagccgagcagtttccgacgacgacgagaactcgggcagcggcgacggc
tctgtcggcccggatcggagcctggcggccaagctgagggagcttgggtcagacagcggc
agcgacgaagaggaccggtccaaacccgcggtggtgaagaaggacgagaaggcgctgttc
ggcagcgacagcgactctggcgaggatgacggagaggagaaaatgatcgcagacattttt
ggagagtctggagatgaggaagaggaggagttcacgggcttcaaccaggaggagctggag
gccgacagcaagcagccgaagcagcagcagcaggcggccgatgagtccgactctgacgaa
ggagtggaccgcagcggccaggacactagcttcatgtctgacttcgacatcatgctagcc
aagaggaaagccatgaacagtcggaagaggaggcatcgagacggaggaacgttcatcagc
gacgccgacgacgtcgtaagcgccatgatcacaaagatgaacgaggccgcagaggaggac
cggactttgaacagccagaagaagccggctctgaagaagctcacgctgctgccgcaggtc
gtcatgcacctcaagaagcaggacctgaaggagacgttcatcgacagtggcgtgatgtcg
gccatcaaggagtggatcagtcctctgcccgacaaatcgctgccggcgctgcgaatcaga
gaggagctgctgcggatcctgcaggagctccccaacgtcagccaggagacactgaagcac
agcgggatcggacgggccgtcatgttcctctacaagcatcccaaagaatcccgggccaac
aaagacctggcgctgaagctcatcaacgaatggtcgcggccgatctttggtctgacgtcc
aactacaagggaatgacgagggaagagcggcagcagagagatctggaccagcagacgcct
cagagacgccggctcagtgagcctcagaaggtggagagggcgcaggaacctgacgttttc
tctccaccaaccagctctggaggtcagacgccccgcagagacctggagaagcagctcacc
ggggaggaaaaagctctgcgacccggtgatcccgggttctgtgcccgggctcgggtgccg
atgccctccaacaaggactatgtggtccgacccaaatggaacgtggagggggattccagc
agggggccggtgaagaagggtttgtcccgggtcgataaacagatgcgaaggtttgcggac
atccggcggctgacgaagactggtcacgctgtgaagatcagcgtggaaggaaaccggatg
ccactctga

DBGET integrated database retrieval system