KEGG   Xanthomonas campestris pv. raphani: XCR_0432Help
Entry
XCR_0432          CDS       T01872                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00010  Glycolysis / Gluconeogenesis
xcp00030  Pentose phosphate pathway
xcp00051  Fructose and mannose metabolism
xcp00052  Galactose metabolism
xcp00230  Purine metabolism
xcp00500  Starch and sucrose metabolism
xcp00520  Amino sugar and nucleotide sugar metabolism
xcp00521  Streptomycin biosynthesis
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01120  Microbial metabolism in diverse environments
xcp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCR_0432
   00030 Pentose phosphate pathway
    XCR_0432
   00051 Fructose and mannose metabolism
    XCR_0432
   00052 Galactose metabolism
    XCR_0432
   00500 Starch and sucrose metabolism
    XCR_0432
   00520 Amino sugar and nucleotide sugar metabolism
    XCR_0432
  Nucleotide metabolism
   00230 Purine metabolism
    XCR_0432
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XCR_0432
Enzymes [BR:xcp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XCR_0432
    5.4.2.8  phosphomannomutase
     XCR_0432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: AEL05358
UniProt: G0CLA3
Position
462337..464622
Genome map
AA seq 761 aa AA seqDB search
MLGGMLLLLAAWFGWSSYAQWREDAIAQTLEQARDRAVQDVCQAMTSQAGQLDAVLKQPQ
VVAALAGGDALAAASAIRERFKGAEDVQVLRGDLSAAYDNPKDFGYARLSLLESALVGER
AQVRVVRDAKQVRLGVAAAVALGGQPAVAYARLPLLRLTGPLDAIAVPGQAYLALRQGSF
NVVEQGDTALADAAETLARPLGDSGLRIAAAVPQSDSGPLGLGALGCAIVAALLLVIAVL
LVLASRGQVALPRRRVAGDAAADEPTFRQSLQQDASVAGEPRALDAATPAPAALVPAVQV
AAEMFRAYDIRGVVGKDLNPGIAALIGQAIGSVMQAQGLRDIVVGRDGRLSGPELTNGLI
EGLRRAGCNVTDIGLAPTPVVYFGAYELRAGSCVAVTGSHNPPDYNGFKIVIGGETLSGA
AITELHQRINEGRLHTAASPGELEQRDISDAYIQRIADDVQLDRPIKVVVDAGNGAAGEI
APRLLEAIGAEVVPLYCDIDGTFPNHHPDPSEPHNLGDLVQMVQRFDADIGVAFDGDADR
LGVVTKEGAIVFPDRLLMLFAADVLQRNPGALVIYDVKCTGKLSDYVLRNGGSPLMWKTG
HSLIKAKMRETDAELAGEMSGHFFFKERWYGFDDGIYAAARLLEILAQREDTPSDVLGEL
PESVSTPEIKVPVDGDAHALVARFVERAQAGEESPFEAARLSTIDGLRADFGDGWGLVRA
SNTTPILVLRFEADTAVALERIRALFRSELQALLPDHPLAF
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
gtgttgggcggcatgctgctgctgttggccgcctggttcggctggagcagctacgcacag
tggcgcgaggacgcgatcgcgcagacgcttgagcaggcgcgcgaccgcgccgtgcaggac
gtttgtcaggccatgacctcgcaggccggccagctggacgccgtgctcaagcaacctcag
gtggtggccgcgttggccggcggcgatgcacttgccgccgcctcggcgatccgcgagcgc
ttcaagggcgccgaggatgtgcaggtgctgcgcggcgacctcagcgcggcgtacgacaac
cccaaggactttggttacgccaggctgagcctgctcgagtcggcgctggtcggcgaacgt
gcccaggtgcgcgtggtgcgcgacgccaagcaggtgcggctgggcgtggccgccgcggtc
gccctgggcggccagccggcggtggcctacgcacggctgccgttgcttcgcctgactggc
ccgctcgatgccattgccgtgcccgggcaggcctatctggcattgcgccagggcagcttc
aacgtggtggagcagggcgataccgcgctggcggacgccgccgaaaccctggcccgcccg
ttgggcgacagtggcctgcgcatcgctgcggcggtgccgcaaagcgacagcggcccgctg
gggctgggcgcgctcggctgcgcgatcgtggcggcattgctgctggtgatcgcggtgctg
ttggtgctggccagccggggccaggtggccttgccgcgccgccgggtggccggtgatgcg
gccgcagacgagccgaccttccgccagagcctgcagcaggacgccagcgtggccggcgag
ccccgcgcgctggacgctgccacgccggcgcccgcggcgctggtcccggccgtgcaggtc
gccgcagaaatgttccgcgcgtacgacatccgcggcgtggtgggcaaggatctcaacccc
ggcatcgccgcgctgatcggccaggccatcggcagcgttatgcaggcgcaaggcctgcgc
gacatcgtggtcggccgcgatggacgtttgtctggcccggaactgaccaacggcctgatc
gaaggcctgcgccgcgccggttgcaacgtcaccgacatcggcctggcgccgacgccggtg
gtgtacttcggcgcctacgaattgcgcgccggcagctgcgtggcggtgaccggcagccac
aatccgcccgactacaacggcttcaagatcgtgatcggcggcgagacgctctccggtgcg
gcgatcaccgagctgcaccagcgcatcaacgaaggccgcctgcataccgcagccagcccc
ggcgaactggagcagcgcgacatcagcgatgcctacatccagcgcattgccgacgacgtg
cagctggatcgcccgatcaaggtggtggtggacgccggcaatggcgcggccggcgagatc
gcgccgcgattgttggaggccatcggtgcggaagtggtgccgctgtattgcgatatcgac
ggcacctttcccaatcatcatcccgacccgagcgagccgcacaatctcggcgatctggtg
cagatggtgcagcgcttcgatgcggatatcggcgtggccttcgatggcgatgccgaccgc
ctgggcgtggtcaccaaggaaggcgccatcgtcttccccgaccgcctgctgatgctgttc
gccgccgatgtgctgcaacgcaatcccggcgcgctggtgatctacgacgtgaagtgcacc
ggcaagctgtccgactacgtgttgcgcaatggcggcagcccgctgatgtggaagaccggg
cattcgctgatcaaggcgaagatgcgcgaaaccgatgccgaactggccggtgaaatgagc
gggcatttcttcttcaaggagcgctggtacggcttcgacgatggcatctatgccgctgcg
cgcctgctggaaatcctcgcccagcgcgaagacaccccgtccgacgtgctcggcgagctg
cccgaaagcgtgtccacgccggagatcaaggtaccggtggacggcgatgcgcatgcgctg
gtggcccggttcgtggagcgtgcgcaggccggcgaggagtcgccgttcgaggccgcgcgg
ttgtccaccatcgacgggctgcgcgcggatttcggcgacggctggggcctggtgcgcgcg
tccaacaccaccccgatcctggtgttgcgcttcgaagccgacaccgctgtggcgctggaa
cgcatccgcgcgctgttccgcagcgaactgcaggcgctgctgccggatcacccgctcgca
ttctga

DBGET integrated database retrieval system