KEGG   Xanthomonas campestris pv. raphani: XCR_2060Help
Entry
XCR_2060          CDS       T01872                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00340  Histidine metabolism
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01230  Biosynthesis of amino acids
Module
xcp_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    XCR_2060 (hisD)
Enzymes [BR:xcp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     XCR_2060 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEL06947
UniProt: G0CC85
Position
2121148..2122443
Genome map
AA seq 431 aa AA seqDB search
MNTLDWTQLTADARTQALTRPVQTVATQTRKAVATLIADVRARGDVALREITARFDGVTL
DSFAVSEAEFAAADAAIAPELRQAMQDAVARIDTFHRAGMSEGYAVETAPGVVCEKIVRP
IGRVGLYVPAGSAPLPSTALMLGVPARLAGCREVVLCTPPRKDGSVDPAVLVAAQLTGVR
RVFKLGGAQAIAAMAYGTDSIPSCDKLFGPGNSFVTEAKQQVAQSGAAAIDMPAGPSEVL
VIADAGAQPAFVAADLLSQAEHGPDSQVLLLSDSDALIAAVQEQLDLQLAQLSRADIARQ
ALAQSRLIKVATLQDAFEISNRYAPEHLILALREPRAWLAQVEAAGSVFLGDYTPEALGD
YCSGTNHVLPTSGAARAYSGVSVASFQNMVSVQAASKAGIDGIGACAVILARAEGLDAHA
NAVALRMGVAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcttgattggacccaactcactgcagacgcacgcacccaggcgttgacgcgc
ccggtgcagaccgtcgccacgcagacacgcaaggcggtcgccaccctgatcgccgatgtg
cgtgcacgcggcgatgtggcgctgcgcgagatcaccgcacgcttcgacggcgtcacgctg
gacagctttgcagtcagcgaggccgaatttgccgcggcagacgccgccatcgcgccagaa
ctacgccaggcgatgcaggacgccgtggcgcgcatcgacacctttcaccgcgccggcatg
agcgaaggctacgcggtggaaaccgcacctggcgtggtctgcgaaaagatcgtgcgcccg
atcggccgcgtgggcttgtacgtgccggccggcagcgcgccattgccgtccaccgccttg
atgctgggcgtgccggcgcggctggctggctgccgcgaagtggtgctgtgcacgccaccg
cgcaaggatggcagtgtcgacccggcggtgctggtggccgcgcaactcaccggcgtgcgc
cgcgtgttcaagctcggtggcgcgcaggcgattgcggcaatggcctatggcaccgactcc
attcccagctgcgacaaattgttcggcccgggcaacagcttcgttaccgaagccaagcag
caggtggcgcaatccggcgcggccgcgatcgacatgccggccggcccgtccgaggtgctt
gtgattgccgatgccggcgcgcaaccggcatttgtcgcggccgatctgttgtcgcaggcc
gaacacggcccggattcgcaggtgctgctgttgtccgacagcgatgcgttgattgccgca
gtgcaggagcaactggacctgcaactggcgcaactctcgcgcgccgacatcgcgcgccag
gcgttggcgcagtcgcggttgatcaaggtggcgacgctgcaggacgcgttcgagatcagc
aaccgctatgcacccgagcacctgatcctggccttgcgcgagccacgtgcgtggttggcg
caggtggaggccgccggctcggtgttcctcggcgactacacgcccgaagcactgggcgat
tactgcagcggcaccaaccacgtgttgccgaccagcggtgcggcgcgtgcctatagcggc
gtgagcgtggccagcttccagaacatggtgagcgtgcaggcggcgagcaaggccggtatc
gatggaattggcgcctgcgcagtgattctggcgcgtgccgagggcctggatgcgcacgcc
aacgcggtggcgctgcgcatgggagtggccgcatga

DBGET integrated database retrieval system