KEGG   Xanthomonas campestris pv. raphani: XCR_2403Help
Entry
XCR_2403          CDS       T01872                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00030  Pentose phosphate pathway
xcp00480  Glutathione metabolism
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01120  Microbial metabolism in diverse environments
xcp01130  Biosynthesis of antibiotics
xcp01200  Carbon metabolism
Module
xcp_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
xcp_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
xcp_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:xcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XCR_2403 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XCR_2403 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcp04147]
    XCR_2403 (zwf)
Enzymes [BR:xcp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     XCR_2403 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     XCR_2403 (zwf)
Exosome [BR:xcp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   XCR_2403 (zwf)
  Exosomal proteins of colorectal cancer cells
   XCR_2403 (zwf)
  Exosomal proteins of bladder cancer cells
   XCR_2403 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AEL07283
UniProt: G0CF12
Position
2507816..2509246
Genome map
AA seq 476 aa AA seqDB search
MHNTLILFGATGDLAQRYLFPSLLRLFVDGLLPEDFRIRALALSPHDTDAFREVLRPRLT
QALPIATAAQIEALLQRVDYRSVDLRNAESVAEAVRELASRQCVSYLAIPPGLYISTCQG
LALGGALAAPHRLMLEKPIGHDSDSAREILQSIGALIDEDRVFRLDHYLGKAAVQNLVAL
RFGNTLLEAVWNRTYIESVQILVAESEGVDGRDAYYARSGALRDMVQSHILQLLCLVAME
PPASLEADRIRDEKVKVLRALRPMTAEHAAHDSVRGRYTAGSINGEPAQAYHPPEGSDVE
TFVAVTAHIDNWRWAGVPFHLCTGKRLAERSTRIVVTLKPVTHWLFERPDRQNAVPNRLS
FQLQPQENIELGLMSSLAGPEWGAIELQPLELELSVPTGLHRRIAYERLFVDAFNGNPAL
FVRDDEVKAAWAWIDSVSDAWSDAQLPLQPYPAGSWGPETAAPFLPPATDAQGNNA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacaccctgatcctgttcggcgccaccggcgatctcgcccagcgctatctcttc
ccatccctgctgcgcctgtttgtcgacggcctgttgccggaggacttccgcatccgtgcg
ctggccctgtcgccgcacgacaccgacgccttccgcgaggtcctgcgcccgcgcctgacc
caggcgctgccgattgccaccgccgcgcagatcgaggcgctgctgcagcgcgtcgactac
cgctcggtggacctgcgcaatgccgaatcggtggccgaggccgtgcgcgaactggccagc
cgccagtgcgtaagctatctggcgattccaccgggcctgtacatcagcacctgccagggc
ctggccctgggcggcgcgctggctgcaccgcaccggttgatgctggaaaaaccgatcggc
cacgattcggacagcgcccgcgagatcctgcagtcgatcggcgcactgatcgacgaagac
cgcgtgttccgtctcgaccactacctgggcaaggccgcggtgcagaaccttgtggcgctg
cgcttcggcaacaccttgctggaagcggtgtggaaccggacctacatcgaatcggtgcag
atcctggtggccgaaagcgaaggcgtggacgggcgcgatgcctactacgcccgctccggc
gcgctgcgcgacatggtgcagagccatatcctgcagttgctgtgcctggtggccatggag
ccgccagcctcgctggaagccgaccgcatccgcgacgagaaggtcaaggtgctgcgcgcc
ttgcgcccgatgaccgccgagcacgccgcgcacgacagcgtgcgtggccgctacaccgcc
ggcagcatcaacggcgagccggcgcaggcttaccacccgccggaaggcagcgatgtggaa
accttcgtcgcggtcaccgcgcacatcgacaactggcgctgggccggcgtgccgttccac
ctgtgcaccggcaagcgcctggccgaacgctccacgcgcatcgtggtcacgctcaagccg
gtgacacattggttgttcgagcgcccggaccgccagaacgcggtgcccaaccgcctgtcc
ttccagctgcagccgcaggaaaacatcgagctgggcctgatgagcagcctggccggcccg
gaatggggtgcgatcgaactgcagccgctggaactggagctgtccgtgcccaccggcctg
caccgccgtatcgcgtatgaacgcttgttcgtggatgccttcaacggcaacccggcgctg
ttcgtgcgcgatgacgaggtcaaggccgcctgggcctggatcgacagcgtcagcgatgcc
tggtcggacgcacagctgccgctgcagccgtatccggccggtagctggggccccgagacc
gccgcaccgttcctgcccccggccaccgacgcacagggaaacaacgcatga

DBGET integrated database retrieval system