KEGG   Xanthomonas campestris pv. raphani: XCR_3438Help
Entry
XCR_3438          CDS       T01872                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00020  Citrate cycle (TCA cycle)
xcp00640  Propanoate metabolism
xcp00660  C5-Branched dibasic acid metabolism
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01120  Microbial metabolism in diverse environments
xcp01130  Biosynthesis of antibiotics
xcp01200  Carbon metabolism
Module
xcp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xcp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XCR_3438
   00640 Propanoate metabolism
    XCR_3438
   00660 C5-Branched dibasic acid metabolism
    XCR_3438
Enzymes [BR:xcp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     XCR_3438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: AEL08300
UniProt: G0CD55
Position
complement(3643425..3644594)
Genome map
AA seq 389 aa AA seqDB search
MNFHEYQSKQLLAEYGIPVPAGKVASTPDEAVEVANSLGKGPWMVKAQIHAGGRGKAGGV
KFCKTTDDVKAAADKMLGTKMSTYQTAGVELPVNLVLVTTAGEIVKELYLSILVDRGTKT
ITYIVSSEGGVEIEQVAAETPELIHSLNVDFVEGVQGYHGRDFGFKLGLNAKQAGQFASI
MVNLYRLFNDKDLALVEINPLAILDDGNLYALDGKFDSDDNAAFRQKALVAMRDKTQEDE
TEVTASELDINYVTMDGNIGCMVNGAGLAMATMDVIKLNGGEPANFLDVGGGANKQRVIE
AFKLILSSDKVEGIFVNIFGGIVRCDMIAEGIIAAVKEVGVKVPVVVRLEGTNVEEGKQL
LRDSGMAIIPADNINDGAKKVVEAVKNAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccacgaataccagtcaaaacagctgcttgccgagtacggcatccccgtcccg
gccggtaaggtcgcgtccacgccggacgaagcggttgaagtcgccaactccttgggcaag
ggcccctggatggtcaaggcgcagatccacgcgggcggccgcggcaaggctggcggcgtc
aagttctgcaagaccaccgacgacgtgaaggccgcagcagacaagatgctcggcaccaag
atgtccacctaccagaccgcaggcgtcgagttgccggtcaacctggtgctggtgaccacc
gccggcgagatcgtcaaggagctgtacctgtcgatcctggtcgaccgcggcaccaagacc
atcacctatatcgtttccagcgagggtggcgtggagatcgagcaggtcgccgccgagacg
ccggagctgatccactcgctcaacgtcgatttcgtcgaaggcgtgcagggctaccacggc
cgcgatttcggcttcaagctcggcctcaatgccaagcaggccggccagttcgccagcatc
atggtgaacctgtatcgcctgttcaacgacaaggacctggcgctggttgaaatcaacccg
ctggcgatcctggacgacggcaacctgtatgcgctggacggcaagttcgacagcgacgac
aacgccgcattccgtcagaaggcgctggtcgccatgcgcgacaagacccaggaagacgag
accgaagtgaccgcttcggagctggacatcaactacgtcaccatggacggcaacatcggt
tgcatggtcaacggcgccggcttggccatggccaccatggacgtcatcaagctcaacggc
ggcgagccggcgaacttcctggacgtgggcggcggtgccaacaagcagcgcgtcatcgaa
gcgttcaagctgatcctgtcctcggacaaggtcgaaggcatcttcgtcaacatcttcggc
ggcatcgtccgctgcgacatgatcgccgaaggcatcattgccgcggtcaaggaagtgggc
gtcaaggtgccggtcgtggtgcgcctggaaggcaccaacgtggaagagggcaagcagctg
ctgcgtgacagcggcatggccatcatcccggccgacaacatcaacgacggcgccaagaag
gtcgttgaagctgtcaagaacgctgcctga

DBGET integrated database retrieval system