KEGG   Xanthomonas campestris pv. raphani: XCR_4276Help
Entry
XCR_4276          CDS       T01872                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00620  Pyruvate metabolism
xcp00630  Glyoxylate and dicarboxylate metabolism
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01120  Microbial metabolism in diverse environments
xcp01200  Carbon metabolism
Module
xcp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCR_4276 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    XCR_4276 (aceB)
Enzymes [BR:xcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     XCR_4276 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AEL09132
UniProt: G0CL53
Position
complement(4584582..4586204)
Genome map
AA seq 540 aa AA seqDB search
MSATAASARPAAADRATPGVSLTTQLAGQAELLPAAALALLVSLHRAIEPGRQQRLAQRR
SRQAAFDAGQLPDFRTDTRAIRAGDWRVAELPAALQDRRVEITGPTDPKMVINALNSGAK
VFMADFEDSTAPTWRNLLTGQRTLAAAVRGELTFDAPNGKHYALRPEHERAVLIVRPRGW
HLDEKHVLIDGQPMAGGLFDAALFAFHNARTLMAKDRGPYLYLPKLQSMEEAALWETALA
HIEAMLGLPHGQIKVTVLIETLPAVFEMDEILHALRARIVGLNCGRWDYIFSYLKTFRAH
PDRVLPERGQVTMTQPFLKAYSELLIKTCHRRGAHAMGGMAAQIPINHDEAANEQAMARV
RADKLREVSAGHDGTWVAHPALIAVAMAVFDEHMPTAHQHHVLRNDVQVTSDMLVATPPG
GITRAGFEGNVEVCVRYLAAWLDGNGCVPIHNLMEDAATAEISRAQLWQWLHHGRHLDDG
TAIDQHLLDTTLRQLPARLGTTAGMPGGARIAEAIGLLDQLSRAEELADFLTVPAYRLID
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaccgccgcttccgcccgtcccgccgccgctgaccgtgccacccccggcgtg
tcgctgaccacccagctggcgggccaggccgagctgctccccgctgccgcgctggctttg
ctggtgtcgctgcaccgggcgatcgagcccggccgccagcagcggctggcgcagcgtcgc
agccgtcaggccgcgttcgacgccggccagttgcccgacttccgcaccgacacccgcgcc
atccgcgccggcgactggcgcgtggccgaactgccggccgccctgcaggaccgccgggtc
gagatcaccggccccaccgatccgaagatggtcatcaacgcgctgaactccggcgccaag
gtgttcatggccgacttcgaagattccaccgcgcctacctggcgcaacctgctgaccggg
cagcgcacgttggcggccgcggtgcgcggcgagctcacattcgatgcgcccaacggcaag
cactacgcgctgcgtccggaacacgaacgtgcggtgctgatcgtgcgcccgcgtggctgg
cacctggacgagaagcacgtgttgatcgatggccagccgatggccggcggcttgttcgat
gcggcgctgttcgccttccacaacgcacgtacgctgatggccaaggaccgcggcccgtac
ctgtatctgcccaagttgcagagcatggaagaagccgcgctgtgggagaccgcgctggcg
catatcgaagcgatgctcggcctgccgcacgggcagatcaaggtcaccgtgctgatcgaa
acgctgccggcggtgttcgagatggacgagatcctgcacgccttgcgcgcacgcatcgtc
gggctcaattgcggccgttgggattacatcttttcgtacctgaaaacctttcgcgcacat
ccggaccgcgtgttgcccgagcgtggccaggtcaccatgacccagccgtttctcaaggcg
tattcggaactgctgatcaagacctgccatcgtcgcggcgcgcatgcgatgggcggcatg
gccgcgcagattccaatcaaccacgacgaggccgccaacgaacaggccatggcgcgtgtg
cgtgccgacaagctgcgcgaggtcagcgccggccatgacggcacctgggtggcgcacccg
gcactgattgcggtggcgatggcggtgttcgacgagcacatgcccaccgcgcatcaacac
catgtgctgcgtaacgatgtgcaggtgacctccgacatgttggttgccacaccgcccggc
ggcatcacccgcgccggtttcgagggcaatgtcgaggtctgcgtgcgttacctggccgcg
tggctggacggcaatggctgcgtgcccatccataacctgatggaagatgcggccactgcg
gaaatcagccgcgcgcaactgtggcaatggctgcatcacggccgccatctcgatgacggc
accgccatcgaccagcacctgctcgacaccactctgcggcagttgccggcgcgcctgggc
accactgctggcatgccgggcggcgcacgtatcgccgaggccatcggcttgctcgaccaa
ctgagccgcgccgaggaattggccgacttcctcacggtgcctgcgtatcgcctgatcgac
tga

DBGET integrated database retrieval system