KEGG   Xanthomonas campestris pv. raphani: XCR_4333Help
Entry
XCR_4333          CDS       T01872                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00071  Fatty acid degradation
xcp00072  Synthesis and degradation of ketone bodies
xcp00280  Valine, leucine and isoleucine degradation
xcp00310  Lysine degradation
xcp00362  Benzoate degradation
xcp00380  Tryptophan metabolism
xcp00620  Pyruvate metabolism
xcp00630  Glyoxylate and dicarboxylate metabolism
xcp00640  Propanoate metabolism
xcp00650  Butanoate metabolism
xcp00900  Terpenoid backbone biosynthesis
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01120  Microbial metabolism in diverse environments
xcp01130  Biosynthesis of antibiotics
xcp01200  Carbon metabolism
xcp01212  Fatty acid metabolism
xcp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCR_4333
   00630 Glyoxylate and dicarboxylate metabolism
    XCR_4333
   00640 Propanoate metabolism
    XCR_4333
   00650 Butanoate metabolism
    XCR_4333
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XCR_4333
   00072 Synthesis and degradation of ketone bodies
    XCR_4333
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XCR_4333
   00310 Lysine degradation
    XCR_4333
   00380 Tryptophan metabolism
    XCR_4333
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XCR_4333
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XCR_4333
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XCR_4333
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcp04147]
    XCR_4333
Enzymes [BR:xcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XCR_4333
Exosome [BR:xcp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCR_4333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEL09189
UniProt: G0CLZ6
Position
complement(4641068..4642363)
Genome map
AA seq 431 aa AA seqDB search
MQGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSSDWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLLAANRAKATGDKLKALLRGFKLGELKPEFPGVAEPRTGK
SMGEHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDSLIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
SAVDFVHGEGLLMAPTVAVPQMLARHGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtcagccgatgcccgcagcccgtcccgtcgccatcctgggcggcgttcgtatc
ccgttctgtcgccagaacaccgcatacgcggacgtgggcaacctgggcatgtcggtgcgc
acgctgggcgcgctggtcgaacgcttcgggctgcatggccagcaactgggcgaggtggcg
atgggggcggtgatcaagcattcctccgactggaacctggcccgtgaagccgcgctgtcg
tcgggcctgtcgccgctgacgccgggcatcaccctgcagcgcgcctgtggcaccagcctg
gattcggtgatcaccatcgccaacaagatcgcgctggggcagatcgactcgggcatcggc
ggcggctcggacaccacctccgaggtgccgatcgtctacggcaagaagctgcgggcgcgc
ctgctggccgccaaccgcgccaaggccaccggcgacaagctcaaggcgctgctgcgtggt
ttcaagctgggcgagctcaagccagagttccccggcgtggccgagccgcgcaccggcaag
agcatgggcgaacactgcgaagacatggccaaggaatggaacatctcgcgtgattcgcag
gacgaatgggcagtggcttcgcaccacaagttggcggccgcgtatgagcgcgggtttttc
gattcgctgattgccccgttccgtggcgtgtcgcgcgacaacatcctgcgcgcggacacc
tcgctggaaaagctggccacgttgcgcccggcgtttgacaagacctccggccgcggcacg
ctcactgccgccaattccaccccgctcaccgatggcgccgccgcggtgctgttgtccagc
gaagcctgggcgctggcccatggccacacgccgatggcctacctgcgcgatgcacaggtc
tcggcggtggatttcgtgcatggcgagggcctgctgatggcgcccacggttgcggtgccg
cagatgctggcccggcacgggctgaccttgcaggacttcgacatctacgagatccacgaa
gccttcgccgcgcaggtgctgtgcacgctgcgcgcctgggagagcgaggattactgccgc
aatcgcctgggactggacgcgccgctgggccgcatcgacccggacaagatcaacccgctg
ggctcctcgctggccaccggccacccgtttgccgcgaccggcgcacgcgtcgtggctacc
gcagccaagcagctggaagaacgcggcggcggacgtgccctgatttcgatctgcaccgcc
ggcggcatgggcgtggtggcgatcgtggaacgctga

DBGET integrated database retrieval system