KEGG   Xanthomonas citri pv. citri MN11: J163_00327Help
Entry
J163_00327        CDS       T03780                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xcr  Xanthomonas citri pv. citri MN11
Pathway
xcr00071  Fatty acid degradation
xcr00072  Synthesis and degradation of ketone bodies
xcr00280  Valine, leucine and isoleucine degradation
xcr00310  Lysine degradation
xcr00362  Benzoate degradation
xcr00380  Tryptophan metabolism
xcr00620  Pyruvate metabolism
xcr00630  Glyoxylate and dicarboxylate metabolism
xcr00640  Propanoate metabolism
xcr00650  Butanoate metabolism
xcr00900  Terpenoid backbone biosynthesis
xcr01100  Metabolic pathways
xcr01110  Biosynthesis of secondary metabolites
xcr01120  Microbial metabolism in diverse environments
xcr01130  Biosynthesis of antibiotics
xcr01200  Carbon metabolism
xcr01212  Fatty acid metabolism
xcr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    J163_00327
   00630 Glyoxylate and dicarboxylate metabolism
    J163_00327
   00640 Propanoate metabolism
    J163_00327
   00650 Butanoate metabolism
    J163_00327
  Lipid metabolism
   00071 Fatty acid degradation
    J163_00327
   00072 Synthesis and degradation of ketone bodies
    J163_00327
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    J163_00327
   00310 Lysine degradation
    J163_00327
   00380 Tryptophan metabolism
    J163_00327
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    J163_00327
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J163_00327
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    J163_00327
Enzymes [BR:xcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     J163_00327
Exosome [BR:xcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J163_00327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJY98077
Position
260733..262013
Genome map
AA seq 426 aa AA seqDB search
MPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVAMGAVI
KHSADWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIGGGSDT
TSEVPIVYGKKLRARLLAANRAKATGDKLRALLRGFKLAELKPEFPGVAEPRTGKSMGDH
CEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADTSLEKL
ATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQVAAVDF
VHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRNRLGL
DAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTAGGMGV
VAIVER
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagcccgtcccgtcgccattctgggcggcgttcgtatcccgttctgtcgtcag
aacaccgcctacgcggacgtgggcaacctgggcatgtcggtgcgcacgctgggcgcgttg
gtcgagcgcttcgggttgcatgggcagcaattgggcgaagtggcgatgggcgcggtgatc
aagcactccgcggactggaacctggcgcgcgaggcggcgctgtcgtcgggtctgtcgccg
ctgacgccgggcatcaccctgcagcgcgcctgcggcaccagcctggattcggtcatcacc
atcgccaacaagatcgcgctggggcagatcgactcgggcatcggcggcggctccgacacc
acctccgaagtgccgatcgtgtacggcaagaagttgcgcgcacggctgctggccgccaac
cgcgccaaggccaccggcgacaagctcagggcgctgctgcgcggcttcaagctggccgag
ctcaagcccgaattccccggcgtggccgagccgcgcaccggcaagagcatgggcgaccat
tgcgaggacatggccaaggaatggaacatctcgcgcgattcgcaggacgaatgggcggtg
gcctcgcaccacaagctggccgctgcctatgagcgcggtttcttcgacgcgctgatcgcg
ccgttccgcggcgtctcgcgcgacaacatcctgcgcgccgacacctcgctggaaaaactc
gcgaccttgcgaccggccttcgacaagacctccggccgtggcacgttgaccgctgccaat
tccaccccgctcaccgatggcgccgccgcggtgctgctctccagcgaagcctgggcgttg
gcgcatggccacacgccgatggcctacctgcgcgatgcacaggtggcggcagtcgacttc
gtgcatggcgaaggcctgctgatggcgcccaccattgcggtgccgcagatgctggcgcgc
cagggcctgaccctgcaggacttcgatatctacgaaatccacgaggccttcgccgcgcag
gtgctgtgcacgctgcgcgcgtgggagagcgaggactactgccgcaaccggctgggcctg
gacgcgccgctgggccgcatcgacccggacaagatcaatccgctgggctcgtcgctggcc
accggccatccattcgccgccactggcgcacgcgtggtggccaccgctgccaagcagttg
gaagagcgcggcggcggccgcgcgttgatttcgatctgcaccgccggcggcatgggcgtg
gtggccatcgtcgagcgctga

DBGET integrated database retrieval system