KEGG   Xanthomonas citri pv. citri MN11: J163_00985Help
Entry
J163_00985        CDS       T03780                                 

Definition
(GenBank) Uncharacterized protein affecting Mg2+/Co2+ transport
  KO
K06195  ApaG protein
Organism
xcr  Xanthomonas citri pv. citri MN11
Brite
KEGG Orthology (KO) [BR:xcr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    J163_00985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AJY98729
UniProt: A0A0U5FAF0
Structure
PDB: 

Position
complement(1023883..1024266)
Genome map
AA seq 127 aa AA seqDB search
MQDDPRYRVEVEVSPRFLAHQSTPDEGRYAFAYSIRIQNAGAVPARLVARHWQITDGNGR
TEQVDGEGVVGEQPWLRPGEAFHYTSGVLLETEQGQMQGHYDMVADDGTEFIAPIAAFVL
SVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgatccgcgctaccgggtcgaggtcgaggtatcgccccgcttcctcgcccat
caatccaccccggacgaaggccgctatgcctttgcctacagcatccgcatccagaatgcg
ggcgcggtgcctgcgcgcctggtcgcgcgccattggcagatcaccgatggcaacggacgc
accgagcaggtggatggcgaaggggtggtcggcgaacagccgtggctgcgcccgggcgaa
gcgttccattacacctctggcgtactgctggagaccgagcagggacagatgcaaggccac
tacgacatggtggccgacgatggcaccgaatttatcgccccgatcgccgccttcgtgctg
agcgtgcccaggacgctgcactga

DBGET integrated database retrieval system