KEGG   Xanthomonas citri pv. citri MN11: J163_02303Help
Entry
J163_02303        CDS       T03780                                 

Definition
(GenBank) precorrin-2 dehydrogenase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
xcr  Xanthomonas citri pv. citri MN11
Pathway
xcr00860  Porphyrin and chlorophyll metabolism
xcr01100  Metabolic pathways
xcr01110  Biosynthesis of secondary metabolites
xcr01120  Microbial metabolism in diverse environments
Module
xcr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xcr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    J163_02303
Enzymes [BR:xcr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     J163_02303
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     J163_02303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 CysG_dimeriser TP_methylase Sirohm_synth_M
Motif
Other DBs
NCBI-ProteinID: AJZ00009
UniProt: A0A0U5FDR6
Position
2516934..2517911
Genome map
AA seq 325 aa AA seqDB search
MPLFPLFANLQGRAVLVIGGGEVATRKVLALLKAQAHIRLYAHALSPELAQLLQAGRFEQ
MTGEFDPGWIDTVWLVVAATDDVELNQRVAAAAGARQRLVNVVDDAELSTYQVPAIVDRD
PLVVAISSAGAAPMLARRLRERLERELHASVGTLAALFAQHRERIRQQLPDMNRRRRWFD
QVIDGQVPQLLQAGDTAAAEAAFAAALEAVDSVPARGSVQWVGAGPGDPGLLTLNALRAL
NLADVLLLATDVPTAVVELARRDAQRRAWPQTLGAQQAVVVELVGAGLQVVVLRMGSGDA
IPAELEAALHAQGILSVGVPGLPLR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgttcccgttgttcgccaacctgcaggggcgcgccgtgctggtcatcggtggc
ggcgaagtcgccacacgcaaggtgctggcgctgctcaaggcgcaggcgcacatccggctg
tatgcgcacgcgctttcgcccgaacttgcccagctgctgcaggccgggcgctttgaacag
atgacaggcgagttcgatcctggctggatcgacaccgtgtggctggtcgtcgcggccacc
gacgatgtggagctgaatcaacgtgtcgccgcagcggccggcgcgcgccagcgcctggtc
aatgtcgtggacgatgccgagctctccacctaccaggtaccggccattgtcgaccgcgat
ccgctggtggttgcgatttcgtcggcaggcgcggcgccgatgctggcgcgccgactgcgc
gagcgactggagcgcgaactgcatgcgtcggtcggtacgctggcggccttgttcgcccag
caccgcgagcgcattcgtcagcagttgccggacatgaaccggcggcgccgctggttcgat
caggtgatcgacggccaggtgccgcaattgctgcaggccggcgataccgccgccgccgaa
gccgcctttgccgccgcgctggaggcggtggacagcgttccggcgcgcggcagcgtgcaa
tgggttggtgccggcccgggcgatccgggcctgcttacgctcaacgccttgcgcgccctg
aacctggccgacgtgctgctgctggcgacggacgtgcccaccgcggtggtggaactggcg
cgccgggacgcgcaacggcgcgcctggccgcagacgctgggcgcgcagcaggccgtcgta
gtggagttggtcggcgccggtctgcaggttgtggtcctgcgcatgggcagcggcgatgcc
atcccggcggagctggaagccgccctgcacgcgcagggcatcctgtcagtgggggtgccg
gggttgccgctccgctag

DBGET integrated database retrieval system