KEGG   Xanthomonas citri pv. citri MN11: J163_04020Help
Entry
J163_04020        CDS       T03780                                 

Definition
(GenBank) Beta-glucosidase-related glycosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
xcr  Xanthomonas citri pv. citri MN11
Pathway
xcr00460  Cyanoamino acid metabolism
xcr00500  Starch and sucrose metabolism
xcr01100  Metabolic pathways
xcr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    J163_04020
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    J163_04020
Enzymes [BR:xcr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     J163_04020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like
Motif
Other DBs
NCBI-ProteinID: AJZ01704
UniProt: A0A0U5BY20
Position
complement(4527306..4529477)
Genome map
AA seq 723 aa AA seqDB search
MAADRIETLIARMTVEEKVGQLGVFADMVRPFAPDVNPEANVLNADEVLQQVRLGRVGSL
FNGVGAALGVQIQKVAVEESRLGIPVILAADVIHGMRTVFPIPLGEAASFEPALAERTAR
ATAIEATAAGLHWTYAPAVDIARDQRWGRGAEGAGEDVMLGAAFAAARVRGFQGSDLTAH
DCLLATPKHFAAYGAVAAGMEYNTVDIAPQTLRDVHLPPFKAAFDAGALTVMSSFNDING
VPASANHELLTEILRGEWQFPGVVISDYTADMELIAHGYAADERDATKKAFLAGLDLSMQ
SGFYAAHLPSLVESGEVPMATLDASVRRILQLKEAIGLFDNPYRSLDPAREADTTHLPAH
DALSRDAARRSIVLLKNEGGVLPLKKSGQRIALIGPFVQDRENIEGCWTLFGDKERYVTL
EQGVRAVVGTEDLSVVAGCGLEEALPGGISAAIDAAQAADVVVLALGEPQRFSGEAQSRT
EITLPPAQQALAEAIAATGTPMVVLLRNGRALALGGAVRDADAIAVTWYLGTQTGTGVAD
VLFGDYNPSARLPISFPQATGQQPYFYNHLRTGRPELPTLSEYKARWREMPNEPLYPFGH
GLSYTTFAYAQPQLSAAQLGWDEALTITTRVSNTGKVAGEEVVQLYVHDRVASRVRPVRE
LKGFRKVLLQPGESQDVVFTLERDALAFTNHKGVFGAEPGLFDVWVCASAKSGEAVTFEL
LER
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgatcgcatcgaaaccctgattgcccggatgaccgtcgaagagaaggtcgga
cagttgggtgtgttcgccgacatggtgcggccgttcgcgccggacgtgaatcccgaggcc
aacgtgctcaatgccgacgaggtgttgcagcaggtgcgcttgggtcgggtcggctcgctg
ttcaatggcgtgggcgccgcgctgggcgtgcagatccagaaagtcgccgtggaagagagt
cgcctggggatcccggtgatcctggccgccgacgtgatccacggcatgcgcacggtgttc
ccgatcccgctgggcgaggcggccagtttcgagccggcgttggccgagcgcaccgcgcgc
gccaccgcgatcgaggccaccgctgccggcctgcactggacctacgcgccggccgtggac
atcgcgcgcgaccagcgctggggccgtggcgccgagggtgccggcgaagacgtgatgctg
ggcgcggcctttgccgctgcccgtgtgcgcgggttccagggcagcgacctgaccgcccac
gattgcctgctggccacgcccaagcatttcgccgcctatggcgcagtggcggcaggcatg
gaatacaacaccgtcgacattgcgccgcagacgctgcgcgatgtgcatttgccgccgttc
aaggccgccttcgatgccggcgcattgaccgtgatgtcgtccttcaacgacatcaacggc
gtaccggccagcgccaaccatgagttgctgaccgagatcctgcgcggggaatggcagttc
cccggcgtggtgatttccgattacaccgccgacatggaattgatcgcccatggctatgcc
gccgacgagcgcgacgcgaccaagaaggccttcctggccgggttggacctgagcatgcaa
agcggcttttatgccgcgcatctgccgtcgctggtggaaagcggcgaggtgccgatggcc
acgttggatgccagcgtgcggcgcatcctgcagctcaaagaagcgatcgggctgttcgac
aatccgtatcgctcgctggacccggcgcgcgaagccgacaccacgcatctgccggcgcac
gatgcgctgtcgcgcgacgcggcgcggcgttcgatcgtgctgttgaaaaacgaaggcggc
gtgttgcctctgaagaagagcggccagcgcatcgcgttgatcggcccgttcgtgcaggac
cgcgaaaacatcgagggctgctggaccctgttcggcgacaaggaacgctacgtgaccctg
gagcagggcgtgcgtgcggtggtcggcaccgaagatctgagcgtggtggcgggctgcgga
ctggaagaggcgctgccgggtggcatttccgctgcgatcgatgcggcgcaggcggccgat
gtggtggtgctggcgttgggcgagccgcagcgtttcagtggcgaggcgcaatcgcgcacc
gagatcaccttgccgccggcgcaacaggcactggctgaagcgattgcagcgaccggcacc
ccgatggtggtgttgttgcgcaatggtcgcgcgctggccttgggtggcgcggtgcgcgat
gccgacgcgattgccgtgacctggtacctgggcacgcagaccggtaccggtgtggccgat
gtgttgttcggcgactacaacccgtcggcgcgtctgccgatcagcttcccgcaggcgacc
gggcagcaaccttatttctataaccatctgcgcaccgggcgcccggaattgccgaccctg
tccgagtacaaggcgcgttggcgcgagatgccaaacgagccgttgtatccgttcgggcat
ggcttgagctacaccacgtttgcgtatgcgcagccgcagttgagcgcggcgcaactcggc
tgggatgaggcgctgaccatcaccacgcgcgtcagcaacaccggcaaggtcgccggcgag
gaagtggtgcagttgtatgtgcacgatcgcgtggccagtcgcgtgcgtccggtgcgcgaa
ctcaaggggtttcgcaaggtattgctgcagcccggcgagagccaggacgtggtgttcacg
ctggagcgcgatgcgctggcattcaccaaccacaagggcgtcttcggtgcggagccgggt
ctgttcgatgtatgggtgtgcgcgtcggccaagagcggcgaggcagtcaccttcgagctg
ctggaacgctga

DBGET integrated database retrieval system