KEGG   Xanthomonas citri pv. citri MN11: J163_04208Help
Entry
J163_04208        CDS       T03780                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
xcr  Xanthomonas citri pv. citri MN11
Pathway
xcr00030  Pentose phosphate pathway
xcr00480  Glutathione metabolism
xcr01100  Metabolic pathways
xcr01110  Biosynthesis of secondary metabolites
xcr01120  Microbial metabolism in diverse environments
xcr01200  Carbon metabolism
Module
xcr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
xcr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
xcr_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:xcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    J163_04208
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    J163_04208
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcr04147]
    J163_04208
Enzymes [BR:xcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     J163_04208
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     J163_04208
Exosome [BR:xcr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   J163_04208
  Exosomal proteins of colorectal cancer cells
   J163_04208
  Exosomal proteins of bladder cancer cells
   J163_04208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N DUF1481
Motif
Other DBs
NCBI-ProteinID: AJZ01883
UniProt: A0A0U5FK64
Position
complement(4730489..4732327)
Genome map
AA seq 612 aa AA seqDB search
MSEQATTPPCIIVVFGARGDLTKRLVMPALYNLRRSGALGDDFAIVGMDHGDISERAWRT
NMGQSMTQLLSSRDAEFQTDEFDTATWDWLRERMHYLRGDFTDQGAYRSLGGVLDKLHKR
YGTQGNVLFYLATAARFFEPVLLNLGEAGLVKQREGEGWRRVIVEKPFGYDLPSAQHLNA
TVAKVLHEDQVFRIDHFLGKETVQNILAFRFANGLFEPVWNRDRIDHVQITAAETIGVEG
RGRFYDPTGCLRDMVPNHLFQLLAMIAMEPPAAFTTEAMHRRRAEVIEAVRPIKPEDVVR
GQYASGAVNRNAVPGYREEDTVPDDSDTETYVAMKLQVDTWRWAGVPFYLRTGKRLRERT
TEIAIRFKPAPLAPFRSTEVGGYGPDWLVLHIQPDEGISLQFDVKRPGAQVALAPVRMDF
RYRDWFPKEYTVGYERLLQDCMNGEAGLFQDAAMVEGAWRIVQPILDAWKQPPSDFPNYA
AGSAGPSAADALLAMNGGHAWRALTPGRKPPPRRPPEARAGAAAPIKKTTGKSAKKAAKA
PAEKVTKAPARRASAASARPSQDAATSPSSAARKAVSKRVTGKVAKAAGKTAAGKGAAKK
SASKTVARTPRR
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcaagcaaccacaccgccgtgcatcatcgtggtgttcggcgcacgcggcgat
ctgaccaagcgcctggtcatgccggcgctgtacaacctgcgccgttccggtgcgctgggc
gatgatttcgccattgtcggcatggaccatggcgacatcagcgagcgcgcctggcggacc
aacatggggcagtcgatgacgcagctgctcagcagccgcgatgccgaattccagaccgac
gaattcgacaccgccacctgggactggctgcgcgaacgcatgcattacctgcgcggcgac
ttcaccgatcagggagcctatcgatcgctgggcggcgtgctggacaagctgcacaagcgc
tacggcacgcagggcaatgtgctgttctatctggccaccgccgcgcgcttcttcgagccg
gtattgctcaacctgggcgaggctggcctggtcaagcagcgcgaaggcgaaggctggcgc
cgggtcatcgtggaaaaacccttcggctacgatctgcccagcgcccagcacctcaatgcc
acggtcgccaaggtgctgcacgaggatcaggtgttccgcatcgatcatttcctgggcaag
gaaaccgtgcagaacattctcgcgttccgcttcgccaatggcttgttcgaaccggtgtgg
aaccgcgaccgcatcgaccatgtgcagatcaccgcggccgaaaccatcggagtggaaggg
cgcggacggttctacgaccccaccggctgcctgcgcgacatggtgccgaaccatctgttc
cagctgctggcgatgattgcgatggagccgccagcggccttcaccaccgaggcgatgcat
cgccgtcgcgccgaagtgatcgaagcggtgcgcccgatcaaacccgaagacgtggtgcgc
gggcaatacgcctccggtgcggtcaatcgcaatgcggtgccgggttatcgcgaagaagac
accgtgcccgacgattcggacaccgaaacctatgtggcgatgaagctacaggtggacacc
tggcgctgggccggcgtgccgttctacctgcgcaccggtaagcgcctgcgcgaacgcacg
accgagatcgccattcgcttcaagccggcaccgctggcgcccttccgcagtaccgaggtg
ggcggctacggccccgactggctggtgctgcatatccagccggacgagggcatctcgctg
cagttcgacgtcaagcgtccgggcgcgcaggtggcactggcaccggtgcgcatggacttc
cgttaccgcgactggttccccaaggaatacacggtgggctacgagcgcctgctgcaggac
tgcatgaacggcgaagccggcttgttccaggatgcggccatggtggaaggcgcatggcgc
atcgtgcaaccgatcctggatgcatggaaacaacccccaagcgacttccccaattacgcc
gccggcagcgccggcccttcggctgccgatgcactactggcaatgaatggcggacacgcc
tggcgcgcactcaccccagggcgcaagccgccaccgcgccggccgccggaagcgcgtgct
ggcgctgccgcgccgattaagaaaaccaccggcaaatctgccaagaaggccgccaaggcg
ccggccgagaaggtcaccaaggcgccagccagacgcgcatctgcggcttcagcaagacca
tcgcaggatgcggctacgtcgcctagcagcgcggccaggaaggccgtgagcaaacgcgta
accggcaaggtcgcaaaggccgccggcaaaaccgcggcaggcaagggcgcagcgaagaag
tcggccagcaagaccgtggcgcgcacgccacgccgctga

DBGET integrated database retrieval system