KEGG   Xanthomonas citri subsp. citri A306: J151_01016Help
Entry
J151_01016        CDS       T03584                                 

Definition
(GenBank) putative SAM-dependent methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
xct  Xanthomonas citri subsp. citri A306
Brite
KEGG Orthology (KO) [BR:xct00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:xct03009]
    J151_01016
Enzymes [BR:xct01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     J151_01016
Ribosome biogenesis [BR:xct03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    J151_01016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AJD67482
Position
complement(1050916..1051959)
Genome map
AA seq 347 aa AA seqDB search
MSGLLCYCRPGFEPELAAELSVRAAFVGIAGYARTQRNDGYVLFVCDEAAQLAAKLQWRE
LIFARQKLVVIAELKGIDPKDRITPILAALDGQQRFGDLWVEHPDSDAGKPLAGLARSFG
NALRPALRKAGLLTDKPQPRQPRLHVCFLDGDHALLAVADSADSAPWPLGIPRLKLLPEA
PSRSALKLDEALLTLLTPEERDALVKPGMRAADLGAAPGGWTWVLTRQHVHVTSVDNGPL
REHVLETGLVEHLRADGFHWKPAQPLDWMVCDMVEQPRRVAERMATWVREGWCRNTIFNL
KLPMKKRWDETRLCLDLFEQQAERSLSVRAKQLYHDREEITVLAMRD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcctgctgtgttactgccggccgggtttcgaacctgagctggccgcagaattg
agtgtgcgcgccgcattcgtcggcattgccggctatgcgcgcacccaacgcaacgacggc
tatgtattgttcgtctgcgacgaagccgcgcaacttgcagcaaaactgcagtggcgcgag
ttgatcttcgcccggcagaagctggtggtgattgccgagctgaaaggtatcgaccccaag
gaccgcatcacgccgatcctggccgcgttggacgggcagcagcgctttggcgatctgtgg
gtggaacacccggattcggacgcgggcaagccgctggcgggcctggcgcgcagcttcggc
aatgcgctgcgcccggctctgcgcaaggccggcctgctcaccgacaagccgcagccgcgc
caacctcggttgcacgtctgttttctcgacggcgaccacgccttgcttgcggtggccgac
agcgccgacagcgccccgtggccactgggcattccacgcctgaaattgctgccggaagcg
ccctcgcgctctgccctcaagctcgacgaagccttgctgacgctgctcacgcccgaagaa
cgcgatgcactggtcaagccgggcatgcgtgcggccgatctgggcgctgcgcccggcggc
tggacctgggtactgacgcggcagcacgtgcacgtcaccagcgtggacaacggcccgctg
cgcgagcatgtgctggagaccgggctggtggaacacctgcgtgccgacggctttcactgg
aagcccgcgcaaccgctggactggatggtctgcgacatggtcgagcaaccgcgccgcgtg
gccgaacgcatggcgacctgggtgcgcgaaggttggtgccgcaacaccatcttcaacctc
aagctaccgatgaaaaagcgctgggacgagacccgtctgtgcctggacctgttcgagcaa
caggccgagagatcattgagcgtgcgcgccaagcagctgtatcacgatcgcgaggagatc
acggtgctggcgatgcgggattga

DBGET integrated database retrieval system