KEGG   Xanthomonas citri subsp. citri A306: J151_01493Help
Entry
J151_01493        CDS       T03584                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xct  Xanthomonas citri subsp. citri A306
Pathway
xct00071  Fatty acid degradation
xct00072  Synthesis and degradation of ketone bodies
xct00280  Valine, leucine and isoleucine degradation
xct00310  Lysine degradation
xct00362  Benzoate degradation
xct00380  Tryptophan metabolism
xct00620  Pyruvate metabolism
xct00630  Glyoxylate and dicarboxylate metabolism
xct00640  Propanoate metabolism
xct00650  Butanoate metabolism
xct00900  Terpenoid backbone biosynthesis
xct01100  Metabolic pathways
xct01110  Biosynthesis of secondary metabolites
xct01120  Microbial metabolism in diverse environments
xct01130  Biosynthesis of antibiotics
xct01200  Carbon metabolism
xct01212  Fatty acid metabolism
xct02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    J151_01493
   00630 Glyoxylate and dicarboxylate metabolism
    J151_01493
   00640 Propanoate metabolism
    J151_01493
   00650 Butanoate metabolism
    J151_01493
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J151_01493
   00072 Synthesis and degradation of ketone bodies
    J151_01493
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    J151_01493
   00310 Lysine degradation
    J151_01493
   00380 Tryptophan metabolism
    J151_01493
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    J151_01493
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J151_01493
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J151_01493
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xct04147]
    J151_01493
Enzymes [BR:xct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     J151_01493
Exosome [BR:xct04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J151_01493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJD67939
Position
complement(1554547..1555722)
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAAKRTAIGSFLGQFNAVPAPTLAAAAIQGALAQSGIAPADISEVIVGCVLPAN
LGQAPARQAAIAAGIPTSTGATTINKVCGSGMKAIMLGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRTGNRYGNFQAVDHMAWDGLTNPYDGQAMGVFGEATAEKFGFSRADQDAFAI
ASVERAHAAQRSGAFADEIVPVTVATRKGDVVVDSDEQPGKSDVAKIPTLKPAFKKDGSV
TAASSSSISDGAAITVLMSADDAQRRGVTPLARIVGHVTHAQEPEWFTTAPVAAIQSLVS
KLGWRLDDVDLFEINEAFAVVAMAPIRQLGIAHDKVNVHGGACALGHPIGASGARLVVTL
VNALRSRGGKRGIATLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgttgctgccaaacgtactgccatcggctcgttcctcggccaa
ttcaatgcggtgccggcacccacgctcgccgcggctgctatccagggcgcactcgcgcaa
tcaggcatcgcgcctgccgatatttccgaagtcatcgtcggctgcgtgctgccggccaat
ctgggccaggcacctgcgcgtcaggccgcgatcgccgcaggcattcctacctcgaccggc
gccaccaccatcaacaaggtgtgcggctcgggaatgaaggcgatcatgttggggcacgac
ctgatcaaggccggctcggccagcatcgtggtggccggcggcatggagtcgatgagcaat
gccccgcatctgctgcccaactcgcgcaccggcaaccgctacggcaattttcaggcggtc
gatcacatggcctgggacggtctgaccaatccgtatgacggccaggccatgggcgtgttc
ggcgaagccactgcggagaagttcggcttcagccgcgccgaccaggatgcgttcgccatc
gcctcggtggaacgcgcgcacgcggcgcagcgcagcggcgcgtttgccgacgaaatcgtg
ccggtgacggtggccacgcgcaagggcgacgtcgtcgtcgacagcgatgagcagccgggc
aagtccgacgtggccaagattccgacgctgaagccagccttcaagaaagacggcagcgtg
accgcggccagttcctcgagtatttccgatggcgcggcaatcaccgtgctaatgagcgcg
gacgacgcgcaacgccgtggcgtgacgccgctggcacgcatcgttggccatgtcacccac
gctcaggaaccggagtggttcaccaccgcaccggtcgctgcgatccagtcgctggtcagc
aagctcggctggcgattggacgatgtggatctgttcgaaatcaacgaagccttcgccgtc
gtggcgatggcaccgatcaggcaactcggcatcgcgcacgataaggtcaatgtgcatggc
ggcgcctgcgcattgggtcatccgatcggtgcatccggcgcgcgtttggtggtgacattg
gtgaacgcgttgcgcagccgcggaggcaagcgcggaatcgccacgctgtgcatcggcggc
ggcgaagccactgccattgctatcgaattgatttaa

DBGET integrated database retrieval system