KEGG   Xanthomonas citri subsp. citri A306: J151_04095Help
Entry
J151_04095        CDS       T03584                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
xct  Xanthomonas citri subsp. citri A306
Pathway
xct00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:xct00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    J151_04095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xct01007]
    J151_04095
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xct03016]
    J151_04095
   03029 Mitochondrial biogenesis [BR:xct03029]
    J151_04095
Enzymes [BR:xct01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     J151_04095
Amino acid related enzymes [BR:xct01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   J151_04095
Transfer RNA biogenesis [BR:xct03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    J151_04095
 Prokaryotic Type
   Other AARSs
    J151_04095
Mitochondrial biogenesis [BR:xct03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    J151_04095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1e tRNA-synt_1 tRNA-synt_1f tRNA-synt_1g RNase_H2-Ydr279
Motif
Other DBs
NCBI-ProteinID: AJD70494
Position
4601637..4603325
Genome map
AA seq 562 aa AA seqDB search
MKALLRALIGQGIEALRANGTLPADTLPPDFVVERPKTREHGDFATNAAMLLAKAARSNP
RALAQALLAALPASDDVAKVEIAGPGFINFHLAPTAYQREVAHVIKQGHDYGRGLAGNGR
SVGVEYVSANPTGPLHVGHGRAAAIGDSLARVLDANGWNVKREFYYNDAGVQIENLALSV
QARAQGLTPDSDGWPENGYRGDYIADVANAYLAGDTVDLEGHLVTGTKDPADLESIRRFA
VAYLRNEQNHDLAAFRVDFDIYFLESSLYKDGKVEEAVQKLIASGHTYEEGGALWLKSTD
FGDDKDRVMRKSDGTYTYFVPDVAYHLTKWQRGYERAITELGADHHGSLTRVRAGLQAME
LGIPQGWPEYVLHQMVTVMRGGEEVKLSKRAGSYVTLRDLIEETSADAVRWFLIARKPDS
QLTFDIDLARAQSNDNPVFYVQYAHARVCSVLRQAQEKGYKYDQAHGLAELACLDDEHSL
AVMLELSRYPEVVEIAGQALEPYQIAQYLRELAHAFHTWYHNSKVLVDAAAERDAKLTLA
VATQQVLANGLELLGVSAPEKM
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccctactccgcgcactgatcggccaaggcattgaagccttgcgcgccaatggc
accctgcccgccgacaccctgccgccggattttgtggtcgagcgacccaagacccgcgag
cacggcgacttcgccaccaacgccgcgatgctgctggccaaggctgcgcgcagcaatccg
cgcgcactggcgcaggcgctgctggcggccctgccggccagcgacgacgtggccaaggtg
gaaatcgccggtccgggcttcatcaatttccacctggcccccaccgcgtatcagcgcgaa
gtggcgcatgtgatcaagcaaggccacgactacggacgcggcctggccggcaacggccgt
tcggtgggcgtggaatacgtctcggccaacccgaccggcccgctgcatgtcggccacggc
cgtgccgcggcgatcggcgacagcctggcgcgcgtgctcgatgccaacggctggaacgtc
aagcgcgagttctactacaacgatgccggcgtgcagatcgagaacctggcgctgtcggta
caggcacgtgcgcaggggctcacccccgacagcgacggctggccggaaaacggctaccgc
ggcgactacatcgccgatgtggccaatgcctacctggccggcgacaccgtcgatctggaa
ggccatctggtcaccggcaccaaggatccggccgatctcgaatcgatccgccgcttcgcg
gtggcgtacctgcgtaacgagcagaaccacgacctggctgcgttccgggtcgatttcgac
atctacttcctggaaagctcgctgtacaaggacggcaaggtcgaagaagcggtgcagaag
ctgatcgcctccggccacacctacgaggaaggcggcgcgctgtggctgaagtccaccgac
ttcggcgacgacaaggaccgcgtcatgcgcaagtccgacggcacctacacctatttcgtg
ccggacgtggcctatcacctgaccaagtggcaacgcggctacgaacgcgccatcaccgaa
ctgggcgccgaccaccacggctcgctgacgcgcgtgcgcgccggcctgcaggcgatggag
ctgggcatcccgcagggttggccggaatacgtgctgcaccagatggtcacggtgatgcgc
ggcggcgaagaagtgaaactgtccaagcgtgccggcagctacgtcaccctgcgcgacctc
atcgaagaaaccagcgccgatgcggtgcgctggttcctgatcgcgcgcaagcccgattcg
cagctgaccttcgatatcgacctggcgcgggcgcagagcaacgacaacccggtgttctac
gtgcagtacgcccatgcgcgggtatgcagcgtgctgcgccaggcgcaggaaaagggctac
aagtacgaccaagcccatggtctggccgagctcgcatgcctggacgacgaacactcgctg
gcggtgatgctggagctgtcgcgttacccggaagtggtggaaatcgccggtcaggcgttg
gagccgtaccagatcgcgcaatacctgcgtgaattggcgcacgccttccacacgtggtat
cacaacagcaaggtgctggtggacgctgccgccgagcgcgacgccaagctcaccctggcg
gtcgccacccaacaggtgctggccaatggcctggaactgctcggcgtcagcgctccggaa
aagatgtaa

DBGET integrated database retrieval system