KEGG   Xanthomonas citri subsp. citri A306: J151_04370Help
Entry
J151_04370        CDS       T03584                                 

Definition
(GenBank) L-fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
xct  Xanthomonas citri subsp. citri A306
Pathway
xct00051  Fructose and mannose metabolism
xct01100  Metabolic pathways
xct01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    J151_04370
Enzymes [BR:xct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     J151_04370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N ImpA_N
Motif
Other DBs
NCBI-ProteinID: AJD70766
Position
4925821..4927143
Genome map
AA seq 440 aa AA seqDB search
MSTIVALDTHDVRFPTSRELDGSDAMNPDPDYSAAYVVLRTDAADDLAGYGLVFTIGRGN
DVQTAAVAALAEHVVGLSVEEVIADLGAFARRLTNDSQLRWLGPEKGVMHMAIGAVINAA
WDLAARAAKKPLWRYIAELSPEQLVDTIDFRYLTDALTRDEALAILRAAQPQRAQRIATL
IEQGYPAYTTSPGWLGYSDEKLVRLAKEAVADGFRTIKLKVGANVRDDIRRCRLAREAIG
PDIAMAVDANQRWDVGPAIDWMRQLAEFDIAWIEEPTSPDDVLGHAAIRQGIAPVPVSTG
EHTQNRVVFKQLLQAGAVDLIQIDAARVGGVNENLAILLLAAKFNVRVFPHAGGVGLCEL
VQHLAMADFVAITGKMEDRAIEFVDHLHQHFLDPVRIRHGRYLAPEAAGFSAEMHAASIA
EFSYPGGRFWVEDLAASAKG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatcgtcgccctcgatacccacgacgtccgcttccccacctcgcgcgagctg
gatgggtcggatgcgatgaatcccgatcccgattactcggcggcctacgtcgtgctgcgc
accgatgcggccgatgacctggccggttacggcctggtgttcaccatcggccgcggtaac
gacgtacagaccgccgcggtggccgcactggccgagcatgtggtcggcctgtcggtcgag
gaagtcattgccgatctgggtgcgttcgcgcgccggctcaccaacgactcgcagctgcgc
tggctgggcccggagaagggcgtgatgcacatggcgatcggcgcggtgatcaacgccgcc
tgggacctggccgcacgcgcggcgaaaaagccgctgtggcgctacatcgccgagctcagc
ccggagcagttggtcgacaccatcgacttccgctacctcaccgacgcgctcacccgcgac
gaagcgctggcgatcctgcgcgctgcgcagccgcagcgtgcgcagcgcatcgccacgctg
attgagcaaggctaccccgcctacaccacctcgcccggctggctcggctactcggacgag
aagctggtgcggctggccaaggaagcggtggccgacggcttccgcaccatcaagctcaag
gtcggcgccaacgtgcgcgacgacattcgtcgctgccgcctcgcgcgcgaagccattggc
ccggacatcgccatggcagtcgatgccaatcagcgctgggacgtgggcccggcgatcgac
tggatgcgccagctggccgaattcgacatcgcctggatcgaagaacccaccagcccggac
gacgtgctcggccatgccgccatccgtcagggcatcgctccggtgccggtctccacgggc
gagcacacgcagaaccgggtggtgttcaagcagttgctgcaggccggtgcggtggacctg
atccagatcgatgccgcgcgcgtgggcggggtcaacgaaaatctcgccatcctgctgctg
gccgccaagttcaacgtgcgcgtcttcccgcatgccggcggtgtgggtctgtgcgagttg
gtacagcatctggcgatggccgatttcgtggccatcaccggcaagatggaagaccgcgca
atcgaattcgtcgaccacctgcaccagcacttcctggacccggtacgcatccggcacggc
cgctatctcgccccggaagccgctggtttctccgcagaaatgcatgccgcctcgattgcg
gagttcagctatccgggcgggcggttctgggtggaggatctggcggccagcgcgaaaggc
tga

DBGET integrated database retrieval system