KEGG   Xanthomonas citri pv. citri UI7: J159_01600Help
Entry
J159_01600        CDS       T03733                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xcu  Xanthomonas citri pv. citri UI7
Pathway
xcu00480  Glutathione metabolism
xcu00590  Arachidonic acid metabolism
xcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    J159_01600
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    J159_01600
Enzymes [BR:xcu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     J159_01600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AJY81582
UniProt: A0A0U5FBJ3
Position
1683083..1683568
Genome map
AA seq 161 aa AA seqDB search
MSDISTFAFTDLEGRTQSMRDYAGNVLLVVNVASKCGFTPQYAGLQALWQRYRERGLVVI
GFPCDQFGHQEPGDAAQIRQFCSLDYAVDFPLAAKIDVNGNGAHPLWQWLKHEQRGVLGS
EAIKWNFTKFLIGRDGRVLERYAPTTKPEALATEIERALDA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatctccaccttcgcattcaccgacctggaaggtcgcacccagtcgatgcgc
gattatgccggcaacgtactgctggtggtcaatgtcgcctccaagtgcgggtttacgccg
caatacgcggggctgcaggccctgtggcagcgttatcgcgaacgtggactggtagtgatc
ggttttccatgcgatcagttcgggcaccaggagccgggcgatgcggcgcagatccgccag
ttctgctcgctcgactatgcggtggattttccgctggccgcgaaaatcgacgtcaacggc
aacggcgcgcatccgctgtggcaatggctcaagcacgaacaacgcggcgtgctcgggtcc
gaggcgatcaagtggaacttcaccaagttcctgatcggccgcgacggccgcgtgctggaa
cgttatgcgcccaccaccaagccggaggcattggctaccgagatcgagcgcgcgctggac
gcatga

DBGET integrated database retrieval system