KEGG   Xanthomonas citri pv. citri UI7: J159_03201Help
Entry
J159_03201        CDS       T03733                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
xcu  Xanthomonas citri pv. citri UI7
Pathway
xcu00270  Cysteine and methionine metabolism
xcu00920  Sulfur metabolism
xcu01100  Metabolic pathways
xcu01110  Biosynthesis of secondary metabolites
xcu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    J159_03201
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    J159_03201
Enzymes [BR:xcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     J159_03201
    2.3.1.46  homoserine O-succinyltransferase
     J159_03201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF429
Motif
Other DBs
NCBI-ProteinID: AJY83150
UniProt: A0A0U5FG60
Position
complement(3532464..3533495)
Genome map
AA seq 343 aa AA seqDB search
MSLVNTASPSTNDFVDTPASSDDGITAVRGELVIALPMRHAGMRELRLRYELIGAANAPV
VFVAGGISAHRHLAASNLFPEKGWVDGLVGSGRALDPASRRLLAFDFLGADGILDAPIDT
ADQADAIAALLDALGIGRLHGFVGYSYGALVGLQFAIRHEARVGTLVAVSGAHRAHPYAA
AWRALQRRAVALGQLQCAEQHGLALARQFAMLSYRTPEEFSERFDAPPEVINGRVRVAAE
DYLDAAGAQYVARTPVNAYLRLSESIDLHRIDPAQVRVPTVVVAVEGDRLVPLADMVSLV
EGLGPRGSLRVLRSPYGHDAFLKEIDRIDAILTTALRSTGETP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgtgaatactgcatcgccgtctaccaacgatttcgttgacacccccgccagc
agcgacgacggcatcactgccgtgcgcggcgaacttgtcatcgccctgccgatgcgccat
gccggcatgcgcgagctgcggctgcgctatgaactgatcggcgccgccaatgcgccggtg
gtgttcgtggccggcgggatttccgcacaccgccatctggccgccagcaacctgttcccc
gagaagggctgggtggatgggctggtgggcagtggccgcgcgctggatccggcatcgcgc
cgcctgctggcattcgattttctcggtgccgacggcatcctggacgcgccgatcgatacc
gccgatcaggccgatgcgattgccgccttgctggatgcgctgggcatcgggcgcttgcac
ggttttgtcggctattcctacggtgcgttggtgggcttgcaattcgcaattcgccacgag
gcccgtgtcggcaccctggtcgcggtgagcggcgcacaccgcgcgcacccgtacgccgcg
gcctggcgtgccctgcaacgtcgcgcggtggcgctgggccagctgcagtgcgcggagcag
catggcctggcgctggcgcgtcagttcgccatgctcagctaccgcacgccggaagaattc
agcgagcgcttcgatgcgcccccggaagtgatcaatggccgggtgcgtgtggccgctgaa
gactatctggacgccgctggcgcgcagtacgtggcgcgcacgccggtgaacgcatatctg
cgcctgtccgaatccatcgacctgcatcgcatcgaccccgcgcaagtgcgcgtgcctacc
gtcgtggtggcggtggagggcgaccgcctggtgccgctggccgacatggtcagcctggtc
gaaggtcttggcccgcgcggcagcctgcgcgtgttgcgctcgccgtacgggcacgacgcc
ttcctgaaagaaatcgatcgcatcgacgcaatcctcactaccgcccttcgcagcaccgga
gaaaccccatga

DBGET integrated database retrieval system