KEGG   Xanthomonas citri pv. citri UI7: J159_04137Help
Entry
J159_04137        CDS       T03733                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
xcu  Xanthomonas citri pv. citri UI7
Pathway
xcu00220  Arginine biosynthesis
xcu00330  Arginine and proline metabolism
xcu01100  Metabolic pathways
xcu01110  Biosynthesis of secondary metabolites
xcu01130  Biosynthesis of antibiotics
xcu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xcu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    J159_04137
   00330 Arginine and proline metabolism
    J159_04137
Enzymes [BR:xcu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     J159_04137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AJY84071
UniProt: A0A0U5FJZ6
Position
complement(4649273..4650196)
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLQEALVGRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMDASYAELRAGRMPIMLGGDHCLGIGSITAVAKYCREQGR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPEALTHLGGSAPALLPEQVRQIGI
RSVDPEEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQDMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccctgattggcgtccctaccgacatcggcgcgggc
caccgcggtgcgcgcatgggaccggaggcgctacgcatcgccggcctgcaggaggcgctg
gtcggccgcggcgtggaggtgcgcgatctgggcaatctggatggtccgcgcaatccctgg
caggcgccgcaggccggctaccggcatctggacgaagtggtggcgtggaaccaggcgctg
atggacgccagctacgccgaactgcgtgccgggcgcatgccgatcatgctcggtggcgac
cattgcctgggcatcggctcgatcacggcggtggccaagtactgccgcgagcagggcagg
ccattgcgggtgctgtggctggatgcgcattcggatttcaacaccagtgaggtgacccct
tcgggcaacgtgcacggcatgccggtggcctgcctgtgcgggctgggccccgaggcgctg
acgcacctgggcggcagtgcgccggcgttgttgcccgagcaggtgcggcagatcggcatc
cgctcggtggacccggaggagaagcggctgatcaagcagcaccgcatcgatgtgtacgac
atgcgctacatcgacgaagccgggatgaagcgcaccatggaagcggcattgcaggacatg
agcgccgatacgcacctgcacgtgagtttcgatgtggatttcctcgaccccagcatcgcg
ccgggcgtgggcaccacggtgcccggtggccccaactaccgcgaggcgcaactggtgatg
gagatgattgccgacaccgggcgcatggggtcgttggatatcgtcgaactcaacccggtg
ctggacaaccgcaacgcgaccgccgaactggcggtggatctggtcgaaagcctgttcggc
aagtcgacgctgatgcgggattga

DBGET integrated database retrieval system