KEGG   Xanthomonas campestris pv. vesicatoria: XCV0141Help
Entry
XCV0141           CDS       T00288                                 

Gene name
glgB1
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00500  Starch and sucrose metabolism
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XCV0141 (glgB1)
Enzymes [BR:xcv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     XCV0141 (glgB1)
Exosome [BR:xcv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCV0141 (glgB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: CAJ21772
UniProt: Q3BZE1
Position
168168..170366
Genome map
AA seq 732 aa AA seqDB search
MMSGVMTAVSNRWDPGAVRALAEARHGDAFAVLGAHPSDNGRFLRTYLPGADRVSAVLDD
GQVVALDAGPEPGLFAGELPAHGGYRLRIGWPGGEQETADPYAFGPQLSDFDLHLISEGH
HLQLADALGANVVEVDGVRGTRFAVWAPNASRVAVVGDFNSWDARRHPMRLRHQAGVWEL
FVPDVGPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPHQWSDDGWMAT
RARRQAHDAPMSIYEIHAGSWLREAGLDLDWDGLADRLIPYVADMGFTHVELMPVSEHPF
GGSWGYQPLGLFAPTARFGTPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGT
ALYEHADPREGFHRDWNTLIYNHGRREVSGFLIASAMEFLQRYHVDGLRVDAVASMLYRD
YSRNAGEWIPNIHGGRENYETIAFLRRLNEVVREHTPGAVMIAEESTAFPGVTADVAHGG
LGFHYKWNMGWMHDTLHYAGLDPIYRRYHHGELTFSMVYAYSERFVLPISHDEVVHGKGS
LLGRMPGDDWQRFANLRAYLGFMFTHPGRKLLFMGCEFGQPTEWNHDAGLPWHLLDDPRH
RGVQTLVRDLNRLYVQYPALHAHDDDPSGFAWVVGDDAGNSVVAFLRKGKRGDAPVLVVI
NFTPVVQHGYRIGVPQGGQWREVFNSDAGIYGGSNLGNGGSVTAEQQSMHGHAQSLPLLL
PPLGAIVLTPYG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtggagtaatgacagcagtgagcaatcgatgggatcccggcgcggtacgcgcc
ctggcagaggcgcgccatggcgacgcgttcgcggtattgggcgcacacccgtccgacaac
gggcgctttttgcgcacctatctacccggcgccgaccgggtcagcgcggtgctcgacgat
gggcaggtggtggcgctggacgctggcccggagccgggcctgttcgccggcgagttgccg
gcgcacggtgggtatcgcctgcgcatcggctggcccggtggcgagcaggagaccgccgac
ccgtacgcgttcggcccgcagctcagtgacttcgacctgcacctgatcagcgaaggccac
cacttgcaattggccgacgcgttgggcgccaacgtggtcgaagtggacggcgtgcgcggc
acgcgctttgccgtctgggcaccgaatgcctcgcgcgtggcggtggtgggcgacttcaac
agctgggacgcgcgccgtcatccgatgcggctgcgtcaccaggccggcgtgtgggagttg
ttcgtgcccgacgtcggccccggcgcacattacaagtaccagctgcgcggtccgcacggg
cacgaactgccggccaaggccgacccggtggcacgccgcgcggagcttgcgccgggcact
gcgtccatcgtggccgatcccacgccgcatcagtggagcgacgacggttggatggccacg
cgtgcgcgccgccaggcccatgacgcgccgatgagcatctacgagatccacgccggctcg
tggttgcgcgaagcaggcctggaccttgattgggacgggctggccgatcgcctgattccg
tacgtggccgatatgggctttacccatgtcgagttgatgccggtgagcgagcatccgttc
ggcggctcctggggctaccagccattgggtctgttcgcgccgaccgcgcgtttcgggaca
cccgatggatttgcgcgctttgtcgaccgctgccaccgcgaaggcatcggcgtaatcgtc
gattgggtgccggcgcactttcccactgatgcgcacggattggcgcatttcgacggcacc
gcgctgtacgagcatgccgacccgcgcgaaggcttccaccgtgactggaatacgctgatc
tacaaccacggccgccgcgaggtatccgggttcctgattgccagtgcgatggaattcctg
cagcgctatcacgtcgatggcctgcgcgtggatgcagtggcttcgatgctgtatcgcgat
tacagccgcaacgccggcgagtggatacccaacatccacggcgggcgcgagaactacgag
accatcgcgttcctgcgccggctcaacgaggtggtgcgcgagcacacgccgggcgcggtg
atgattgccgaggaatccactgcgtttcccggtgtcaccgccgacgtggcgcacggcggc
ctgggctttcactacaagtggaacatgggctggatgcacgacaccctgcattacgccggg
ctggatccgatctatcgccgctaccaccacggtgagctgactttcagcatggtctatgcg
tattcggagcgcttcgtgctgccgatctcgcacgacgaagtggtgcacggcaagggttcg
ttgctgggccgcatgccgggcgacgattggcagcgcttcgcgaatctgcgtgcttacctg
ggtttcatgttcacccacccggggcgcaagttgctgttcatgggctgcgaattcggtcaa
ccgaccgagtggaaccacgacgccggccttccgtggcatttgctcgacgaccctcgccat
cgtggtgtgcagacgttggtgcgcgatttgaaccggctgtatgtgcaatacccggcgctg
catgcgcacgacgacgatccgtccggattcgcctgggtggtgggcgacgatgccggcaat
agcgtggtggcgttcctgcgcaagggcaaacgtggcgacgcaccggtgctggtggtgatc
aacttcactccggtcgtgcagcacggctatcgcatcggcgtgccacaaggcggccagtgg
cgcgaggtgttcaacagcgacgccggcatctacggcggcagcaacctgggcaatggcggc
agcgtgacggccgagcagcaatccatgcatgggcacgcgcaatcgctgccgctgctgttg
ccaccgctgggcgccatcgtgctgacgccgtatggctga

DBGET integrated database retrieval system