KEGG   Xanthomonas campestris pv. vesicatoria: XCV0198Help
Entry
XCV0198           CDS       T00288                                 

Definition
(GenBank) acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00071  Fatty acid degradation
xcv00072  Synthesis and degradation of ketone bodies
xcv00280  Valine, leucine and isoleucine degradation
xcv00310  Lysine degradation
xcv00362  Benzoate degradation
xcv00380  Tryptophan metabolism
xcv00620  Pyruvate metabolism
xcv00630  Glyoxylate and dicarboxylate metabolism
xcv00640  Propanoate metabolism
xcv00650  Butanoate metabolism
xcv00900  Terpenoid backbone biosynthesis
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
xcv01130  Biosynthesis of antibiotics
xcv01200  Carbon metabolism
xcv01212  Fatty acid metabolism
xcv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCV0198
   00630 Glyoxylate and dicarboxylate metabolism
    XCV0198
   00640 Propanoate metabolism
    XCV0198
   00650 Butanoate metabolism
    XCV0198
  Lipid metabolism
   00071 Fatty acid degradation
    XCV0198
   00072 Synthesis and degradation of ketone bodies
    XCV0198
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XCV0198
   00310 Lysine degradation
    XCV0198
   00380 Tryptophan metabolism
    XCV0198
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XCV0198
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XCV0198
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XCV0198
Enzymes [BR:xcv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XCV0198
Exosome [BR:xcv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCV0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAJ21829
UniProt: Q3BZ84
Position
233910..235205
Genome map
AA seq 431 aa AA seqDB search
MPGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSADWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLLAANRAKATGDKLRALLRGFKLAELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDSLIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
AAVDFVHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcaaccgatgcccgcagcccgtcccgtcgccattttgggcggcgttcgtatc
ccgttctgtcgtcagaacaccgcgtacgcggatgtgggcaacctgggcatgtcggtgcgc
acgctgggcgcgttggtcgagcgcttcgggttgcatgggcagcaattgggcgaagtggcg
atgggcgcggtgatcaagcattccgcggactggaacctggcgcgcgaggcggcgctgtcg
tcgggtctgtcgccgctgacgccgggcatcaccctgcagcgcgcctgcggcaccagcctg
gattcggtgatcaccatcgccaacaagatcgcgctggggcagatcgactcgggcatcggc
ggcggctctgacaccacctccgaagtgccgatcgtgtacggcaagaagttgcgcgcacgg
ctgctggccgccaaccgtgccaaggccaccggcgacaagctcagggcgctgctgcgtggc
ttcaagctggccgagctcaagcccgagttccccggcgtggccgagccgcgcaccggcaag
agcatgggcgaccactgcgaggacatggccaaggaatggaacatctcgcgcgattcgcag
gacgaatgggcggtggcttcgcaccacaagctggccgctgcctatgagcgcggtttcttc
gactcgctgatcgcgccgttccgcggcgtctcgcgcgacaacatcctgcgcgcggacacc
tcgctggaaaaactcgccacgctacgcccggccttcgacaagacctccggccgcggcacg
ttgaccgccgccaattccaccccgctcaccgatggcgccgccgcggtgctgctctccagc
gaagcctgggcgctggcgcatggccacacgccgatggcctacctgcgcgatgcacaggtg
gcggcagtcgacttcgtgcatggcgaaggcctgctgatggcgcccaccatcgcggtgccg
cagatgctggcgcgtcagggcctgaccctgcaggatttcgacatctacgaaatccacgag
gccttcgccgcgcaggtgctgtgcacgttgcgtgcctgggagagcgaggattactgccgc
aatcgcctcgggctggatgcgccgctgggacgcatcgacccggacaagatcaatccgctg
ggctcgtcgctggccaccggccatccgttcgccgccactggcgcacgcgtggtggccacg
gccgccaaacagctggaagagcgcggcggcggccgtgcattgatttcgatctgcaccgcc
ggcggcatgggcgtggtggcgatcgtcgagcgctga

DBGET integrated database retrieval system