KEGG   Xanthomonas campestris pv. vesicatoria: XCV0265Help
Entry
XCV0265           CDS       T00288                                 

Gene name
aceA
Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00630  Glyoxylate and dicarboxylate metabolism
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
xcv01200  Carbon metabolism
Module
xcv_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XCV0265 (aceA)
Enzymes [BR:xcv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XCV0265 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CAJ21896
UniProt: Q3BZ17
Position
306218..307513
Genome map
AA seq 431 aa AA seqDB search
MSTTLQSAEQLQQDWSNNPRWSGITRNYSAADVVRLRGTVHVEHSLARLGAEKLWTSLHA
TPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVK
RINNTLLRADQLHHAEGNDAIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEAADLITSDVDA
NDQPFTTGQRTVEGFFKTRNGLDQAISRGLAYAPYADLIWCETGKPDLEFARAFAQAIHA
RFPGKLLAYNCSPSFNWKKNLDDATIAKFQTELASYGYKFQFITLAGFHALNYGMFHLAH
GYARRQMSAFVELQQAEFEAAERGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALRGST
EEAQFHSDKAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacactgcaaagcgccgaacaactgcagcaggactggtccaacaacccgcgc
tggagcggcatcacccgcaattacagcgctgccgatgtggtgcgcctgcgtggcaccgtg
catgtcgagcactcgctggcgcggttgggcgcggaaaaattgtggacctcattgcatgcc
acgccgttcgtcaatgcgctgggcgcattgaccggcaaccaggccatgcagcaggtcaag
gccggcttgaaggcgatttacctgagcggctggcaggttgccgccgacgccaatctggcc
gggcagatgtatccggaccaatcgctgtacccggccgattcggtgccggcggtggtcaag
cgcatcaacaacaccttgctgcgcgccgaccagttgcaccatgccgaaggcaacgatgcc
atcgacttcctgcagccgatcgtggccgacgccgaagccggtttcggtggcgtgctcaac
gccttcgaactgatgaaggcgatgatcgaagccggcgcggctggcgtgcacttcgaagac
caactggcctcggtcaagaagtgcggccacatgggcggcaaggtgctggtgcccacgcgt
gaggcgatcgaaaaattgaatgccgcgcgcctggctgccgacgtgctgggcgtgccgacg
gtgctgatcgcacgcaccgacgccgaagccgccgacctgatcaccagcgacgtggatgcc
aacgaccaaccgttcaccaccgggcagcgcacggtcgaaggcttctttaagacccgcaat
ggcctggaccaggcgatcagccgcggcttggcctatgccccgtacgccgacctgatctgg
tgcgaaaccggcaagccggacctggaatttgcgcgtgcgtttgcgcaggccatccatgcc
aggttccccggcaaattgctggcctacaactgctcgccgagtttcaattggaagaagaat
ctggacgatgccaccatcgccaaattccagaccgaactggcgagctatggctacaagttc
cagttcatcaccctggctggcttccacgccttgaactacggcatgttccatctggcgcac
ggctatgcgcgccggcagatgagtgcgttcgtcgaattgcagcaggccgagttcgaagcg
gcggagaggggatttaccgcagtcaagcaccagcgcgaagtaggcaccggctatttcgat
gcagtgacgcaggcgatccagcaggggcaatcgtccaccaccgccttgcgtggctccacc
gaagaagcgcaattccatagcgacaaggcggcctga

DBGET integrated database retrieval system