KEGG   Xanthomonas campestris pv. vesicatoria: XCV0473Help
Entry
XCV0473           CDS       T00288                                 

Definition
(GenBank) putative dihydrolipoamide acyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00010  Glycolysis / Gluconeogenesis
xcv00020  Citrate cycle (TCA cycle)
xcv00620  Pyruvate metabolism
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
xcv01130  Biosynthesis of antibiotics
xcv01200  Carbon metabolism
Module
xcv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV0473
   00020 Citrate cycle (TCA cycle)
    XCV0473
   00620 Pyruvate metabolism
    XCV0473
Enzymes [BR:xcv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XCV0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAJ22104
UniProt: Q3BYF9
Position
complement(534361..535869)
Genome map
AA seq 502 aa AA seqDB search
MSDNKNFHLPDLGEGLPDATIVEWFVKEGDTVRLDDPLVSMETAKAVVEVPSPFSGTVVK
LAGAAGDVIVTGSVLAQFALDASQPQRADGQDTGHSHGPAPTHAPTPSTGDSAAGHTTRV
VASDNGGEIADADAGDGSSDRDDAGTVVGAMQSSNAVQSEQAITVGGVRAMPVVRALARK
LRVDLVQVRATGPDGTVTLADVKQAAAAGTAQPSPGAHGAPTSPASGRGGPIGDGGRAAG
SAADGRDRPATAPLLPPAGEGARRADEGNARSTLSASGKPMRTQSPGISAKGQPEQLKGV
RRNMARVMADAHTKVVPTTLNDDADLHAWQPGNDVTVRLVRGIVRACQAVPALNAWFDGD
ALSRTLHHQVDIGIAVDTEEGLFVPALRNADMLDAHGIREGVNRLRQQVESRSIAASELS
GYTISLSNFGMFAGRYATPVVVPPCVAIVAAGRARYQLTPVMGGVETHKVMPLSLTFDHR
AATGGEAARFLRALLDDLALAN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaacaagaatttccacctgcccgacctgggcgaaggcctgcccgacgccacc
atcgtggaatggttcgtcaaggagggcgacaccgtgcgcctggacgacccgctggtgtcg
atggaaaccgccaaggcggtggtcgaggtgccctcgccgttttccgggaccgtggtcaag
ctcgccggcgccgccggcgatgtgatcgtgaccggctcggtgctggcgcagttcgcgctg
gatgcctcgcagccgcaacgcgccgacggccaggacaccggccattcgcatggaccggcg
ccgacgcacgcacccacgcccagcaccggcgacagcgcggctgggcacaccacgcgcgtg
gtggcctccgataacggcggcgaaattgccgatgccgatgctggcgatggcagcagcgat
cgcgacgatgccggcaccgtggtcggcgcgatgcagagctccaacgccgtgcagagcgag
caggccattaccgtcggcggcgtgcgcgccatgccggtggtgcgcgcgctggcgcgcaag
ctgcgtgtggacttggtacaggtgcgcgctaccggcccggacggcacggtcacgctggca
gacgtaaagcaggcagcggccgccggtaccgcgcagccctcacccggcgcgcacggcgcg
ccgacctctcctgccagcgggcgaggtggtccgatcggtgacggtgggagagctgctggg
agcgctgccgacggcagggatcgacccgcaacagcaccccttcttccgcctgcgggagaa
ggtgcccgcagggcggacgagggcaacgcccgctccacgctgtcggccagcggcaagccg
atgcgcacccagtcgcccggcatcagcgccaagggccaacccgagcaactcaagggcgtg
cgccgcaacatggcacgtgtgatggccgatgcacacaccaaggtggtgccgaccacgctc
aacgacgatgccgatctgcacgcctggcagcccggtaacgatgtcaccgtgcgtctggtg
cgcggtatcgtgcgcgcctgccaggcggtgcccgcactcaatgcctggttcgacggcgac
gcactcagccgcaccctgcaccaccaggtcgacatcggcattgccgtggataccgaagaa
ggcctgttcgtgccggcgttgcgcaacgccgacatgctggatgcgcatggcattcgcgaa
ggcgtcaaccggctgcgccagcaggtggaaagccgcagcatcgccgcgtccgaactgagc
ggctacaccatctcgctgtccaacttcggcatgtttgccggccgctacgccacgccggtg
gtggtgccgccctgcgtggcgatcgtggccgccggccgcgcgcgctaccagctcaccccg
gtgatgggcggcgtggaaacgcacaaggtgatgccgctgtcgctgaccttcgatcaccgc
gccgccaccggtggtgaagcggcgcgcttcctgcgcgccttgctggacgatctggcgttg
gccaactga

DBGET integrated database retrieval system