KEGG   Xanthomonas campestris pv. vesicatoria: XCV0899Help
Entry
XCV0899           CDS       T00288                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06195  ApaG protein
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    XCV0899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: CAJ22530
UniProt: Q3BX83
Position
complement(1027870..1028253)
Genome map
AA seq 127 aa AA seqDB search
MQDDPRYRVEVEVSPRFLAHQSTPDEGRYAFAYSIRIQNAGAVPARLIARHWQITDGNGR
TEQVDGEGVVGEQPWLRPGEAFHYTSGVLLETEQGQMQGHYDMVADDGTEFIAPIAAFVL
SVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgatccgcgctaccgcgtcgaggtcgaggtatcgccccgcttcctcgcccat
caatccaccccggacgaaggccgctacgcctttgcctacagcatccgcatccagaatgcg
ggcgcggtgcctgcgcgcctgatcgcgcgtcattggcagatcaccgatggcaacgggcgc
accgagcaggtggatggcgaaggcgtggtcggcgaacagccgtggctgcgaccgggcgaa
gctttccattacacctccggcgtactgctggagaccgagcagggacagatgcagggccac
tacgacatggtggccgacgatggcaccgaatttatcgctccgatcgccgccttcgtgctg
agcgtgcccaggacgctgcactga

DBGET integrated database retrieval system