KEGG   Xanthomonas campestris pv. vesicatoria: XCV1054Help
Entry
XCV1054           CDS       T00288                                 

Gene name
phlN1
Definition
(GenBank) phospholipase C precursor
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00562  Inositol phosphate metabolism
xcv00564  Glycerophospholipid metabolism
xcv00565  Ether lipid metabolism
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    XCV1054 (phlN1)
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    XCV1054 (phlN1)
   00565 Ether lipid metabolism
    XCV1054 (phlN1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    XCV1054 (phlN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:xcv02042]
    XCV1054 (phlN1)
Enzymes [BR:xcv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     XCV1054 (phlN1)
Bacterial toxins [BR:xcv02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   XCV1054 (phlN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-ProteinID: CAJ22685
UniProt: Q3BWS8
Position
1182652..1184751
Genome map
AA seq 699 aa AA seqDB search
MTSSSSSSRRDFLKRVAALTAAGALPPSIGRALALPANARTGTLRDLEHVVILMQENRSF
DHYFGALRGVRGFGDPRALQLRDGHPVWSQPTSDGRRLLPFAFDSQHTCAPLIKSLDHSW
KAGHGQEPARWAEYDAWVPYKGELTMGYFQRHDIPYYHALADAFTICDGYYCSLHGPTNP
NRMYLFTGTSGPSVGNVGAQAVTNADDGNWTADMARDKPGYAALQWTTYAQRLQAAGVDW
RVYQEYDNFGCNSLAYFSHYRDLRTDDERYRRARACVPGSTADNAATTQAEHLVAAIAAD
VQANRLPQVSWVIPPTAYCEHPEAPPAYGESLVARLIDALTANPEVWAKTALIINYDEND
GFFDHVPAPLPAVDARMGRSNVDTRGEVYDGVPIGLGIRVPMLVISPWTRGGWVNSQVFD
HTSVLRLLERRFGVAEPNISPWRRAVSGDLTSVFDFRKPDDSALSALPSVDDYRARTAAV
RDKPLPSVPAAAAMPRQEPGQRPARALPYALQVHARVQEGAPVQLQFVNSGAAAAAFNVY
SSAASGGPWYYTVLPGTQLEDAPVGATHAGAYALRVHAPNGFLREFAGQVPSASAPSAAP
WVEARQEGDALVLEIGNAGQRACTVQLRALDYADPDARTLPLAAGQRETIRLALAASDHW
YDLVVEQPGSAFRRRLAGHLETGRPSRSDPAFGRCAQTS
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgacctcttcctcttcctcttcgcgtcgcgatttcctcaagcgcgtcgctgcgctcact
gctgccggcgccttgccgccttcgatcggccgtgcgctcgcgctgccggccaacgcgcgg
accggcacgttgcgcgatctcgaacatgtggtgatcctgatgcaggaaaaccgctcgttc
gatcattatttcggcgcgctacgtggcgtgcgtggctttggcgatccgcgcgcgctgcaa
ctgcgcgatggccatccggtatggagtcaacccacgtccgatggacgacgcttgctgccg
ttcgcgttcgattcgcaacatacctgcgcgcccttgatcaagagcctggatcattcctgg
aaggccggtcacgggcaggagccggcacgctgggccgaatacgatgcgtgggtgccgtac
aagggggaattgacgatgggatacttccagcgtcacgacatcccgtactaccacgcgctg
gccgacgcgttcaccatctgcgacggctattactgctcgctgcacgggccgaccaatccc
aaccgcatgtatctgttcaccggtaccagcggcccaagcgtgggcaacgtcggcgcgcag
gcggtgaccaatgccgacgatggcaactggaccgccgacatggcgcgcgacaagcccggc
tacgcagcactgcagtggaccacgtacgcgcagcgtttgcaggctgccggcgtggactgg
cgcgtgtatcaggaatacgacaacttcggctgcaactcgctggcgtacttctcgcactac
cgcgatctacgcaccgacgacgaacggtaccggcgtgcacgtgcgtgcgtgcccgggtca
accgcggacaatgccgccaccacccaggccgagcatctggtcgccgcgatcgctgccgat
gtgcaggccaatcgcctgccgcaggtgtcgtgggtcatcccgcccaccgcgtactgcgaa
catcccgaagcgccgcctgcctatggcgagtcgctggtggcgcgtctgatcgatgcgctc
accgccaatcccgaggtgtgggccaagacggcactgatcatcaattacgacgagaacgac
ggcttcttcgatcacgtgcccgcgccgttgccggcagtggacgcacgcatggggcgcagc
aatgtcgacacgcgtggcgaggtctacgatggcgtgccgatcggcctgggcattcgcgtg
ccgatgctggtgatctcgccgtggacacgtggtggctgggtcaactcgcaggtgttcgat
cacacctcggtcctgcgtctgctggaacgccgcttcggcgtggccgagccgaacatcagc
ccatggcggcgtgcggtcagcggcgatctcaccagcgtgttcgacttccgcaaaccggac
gattcggcgttgagcgcattgccgtcggttgacgactatcgcgcacgtaccgctgccgta
cgcgataaaccgctaccgtctgtgcctgccgccgcagcgatgccgcggcaggaaccgggg
caacggccggcgcgcgcattgccgtatgccttgcaggtgcatgcacgcgtgcaagagggc
gcccccgtgcagttgcagttcgtcaacagcggcgcggcggccgcggcgttcaacgtctac
agcagcgcggccagtggcggcccctggtattacacggtgctgcccggcacgcagctggag
gatgcgccggtcggggccacgcacgcgggtgcatacgccttgcgcgtgcacgcgccgaat
ggcttcttgcgcgagttcgccgggcaggtgccaagtgcctctgcgccatcggccgcgcca
tgggtggaggcgcggcaggagggcgacgccttggtgctggaaatcggcaatgccgggcag
cgcgcctgcaccgtgcagctgcgtgcgctggactacgcagacccagatgcgcgcaccttg
ccgctggccgcaggtcagcgcgagaccattcgcctggcgcttgccgccagcgatcactgg
tacgacctggtggtggaacagccgggcagcgctttccgccgccggctggccgggcatctg
gaaaccggcaggcccagccgcagcgaccccgcgttcggccgatgtgcgcagacctcgtga

DBGET integrated database retrieval system