KEGG   Xanthomonas campestris pv. vesicatoria: XCV1401Help
Entry
XCV1401           CDS       T00288                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00071  Fatty acid degradation
xcv00072  Synthesis and degradation of ketone bodies
xcv00280  Valine, leucine and isoleucine degradation
xcv00310  Lysine degradation
xcv00362  Benzoate degradation
xcv00380  Tryptophan metabolism
xcv00620  Pyruvate metabolism
xcv00630  Glyoxylate and dicarboxylate metabolism
xcv00640  Propanoate metabolism
xcv00650  Butanoate metabolism
xcv00900  Terpenoid backbone biosynthesis
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
xcv01130  Biosynthesis of antibiotics
xcv01200  Carbon metabolism
xcv01212  Fatty acid metabolism
xcv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCV1401 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    XCV1401 (thlA)
   00640 Propanoate metabolism
    XCV1401 (thlA)
   00650 Butanoate metabolism
    XCV1401 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XCV1401 (thlA)
   00072 Synthesis and degradation of ketone bodies
    XCV1401 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XCV1401 (thlA)
   00310 Lysine degradation
    XCV1401 (thlA)
   00380 Tryptophan metabolism
    XCV1401 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XCV1401 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XCV1401 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XCV1401 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcv04147]
    XCV1401 (thlA)
Enzymes [BR:xcv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XCV1401 (thlA)
Exosome [BR:xcv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCV1401 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAJ23032
UniProt: Q3BVT1
Position
complement(1581204..1582379)
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAAKRTAIGSFLGQFNAVPAPTLAAAAIQGALAQSGIAPADISEVIVGCVLPAN
LGQAPARQAAIAAGIPTSTGATTINKVCGSGMKAIMLGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRTGNRYGNFQAVDHMAWDGLTNPYDGQAMGVFGEATAEKFGFSRADQDAFAI
ASVERAQAAQRSGAFADEIVPVTVTTRKGDVVVDSDEQPGKSDVAKIPTLKPAFKKDGSV
TAASSSSISDGAAITVLMSADDAQRRGVTPLARIVGHVTHAQEPEWFTTAPVAAIQSLVS
KLGWRLDDVDLFEINEAFAVVAMAPIRQLGIAHDKVNVHGGACALGHPIGASGARLVVTL
VNALRSRGGKRGIATLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgttgctgccaaacgtactgccatcggctcgttcctcggccaa
ttcaatgcggtgccggcacccacgctcgccgcggctgctatccagggcgcactcgcgcaa
tcgggcatcgcgcctgccgatatttccgaagtcatcgtcggctgcgtgctgccggccaat
ctgggccaggcacctgcgcgtcaggccgcgatcgccgcaggcattcctacctcgaccggc
gccaccaccatcaacaaggtgtgcggctcgggaatgaaggcgatcatgttggggcacgac
ctgatcaaggccggctcggccagcatcgtggtggccggcggcatggagtcgatgagcaat
gccccgcatctgctgcccaactcgcgcaccggcaaccgctacggcaattttcaggcggtc
gatcacatggcctgggacggtctgacgaatccgtatgacggccaggccatgggcgtgttc
ggcgaagccactgcggagaagttcggcttcagccgcgccgaccaggatgcgttcgccatc
gcctcggtggaacgcgcgcaggcggcgcagcgcagcggcgcgtttgccgacgaaatcgtg
ccggtgacggtgaccacgcgcaagggcgacgtcgtcgtcgacagcgatgagcagccgggc
aagtccgacgtggccaagattccgacgctgaagccagccttcaagaaagacggcagcgtg
accgcggccagttcctcgagtatttccgatggagcggcaatcaccgtgctaatgagcgcg
gacgacgcgcaacgccgtggcgtgacgccgctggcacgcatcgttggccatgtcacccac
gctcaggaaccggagtggttcaccaccgcaccggtcgctgcgatccagtcgctggtcagc
aagctcggctggcgattggacgatgtggatctgttcgaaatcaacgaagccttcgccgtc
gtggcgatggcaccgatcaggcaactcggcatcgcgcacgataaggtcaatgtgcatggc
ggcgcctgcgcattgggtcatccgatcggtgcatccggcgcgcgtttggtggtgacattg
gtgaacgcgttgcgcagccgcggaggcaagcgcggaatcgccacgctgtgcatcggcggc
ggcgaagccactgccattgctatcgaattgatttaa

DBGET integrated database retrieval system