KEGG   Xanthomonas campestris pv. vesicatoria: XCV1577Help
Entry
XCV1577           CDS       T00288                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00020  Citrate cycle (TCA cycle)
xcv00310  Lysine degradation
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
xcv01130  Biosynthesis of antibiotics
xcv01200  Carbon metabolism
Module
xcv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xcv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XCV1577 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    XCV1577 (sucB)
Enzymes [BR:xcv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     XCV1577 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H SAPS
Motif
Other DBs
NCBI-ProteinID: CAJ23212
UniProt: Q3BVA5
Position
complement(1779692..1780906)
Genome map
AA seq 404 aa AA seqDB search
MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FDTGSTVTSNQILAIIEEGAVAAAAPAEEKKADAPAPAAAAPAAAPAPAAAAAPAAASKS
AADALPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNFAKAGGVGKASGARPEERVPM
TRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEFQKAHGIKLGFMSFFVKA
AANALQRFPLVNASIDGDDIIYHGYSDISIAVSTDKGLVTPVLRNVERQSFADVEQGIAD
YAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPPQSAILGMHAIKERPIAENGQ
VVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagttccggtactgcccgaatccgtttccgacgccaccatcgcc
agctggcacaagaaggccggcgaagcggtcaagcgcgacgagaatctggtcgacctggaa
accgacaaggtcgtgttggaagttccttcgccggtcgacggcgtactgaaggaaatcaag
ttcgacaccggcagcacggtcaccagcaaccagattctggcgatcatcgaagaaggcgcc
gtggctgccgctgcaccggctgaagagaagaaggccgatgcaccggcgcctgccgctgct
gcgccggccgccgctccggcaccggctgccgccgccgcgcctgctgctgcgtccaagtcg
gctgccgatgcgctgccgccgggtgcgcgtttctccgcaatcacccagggcgtggacccg
tcgcaggtcgaaggcaccggccgtcgtggcgcggtcaccaaggaagacatcgtcaacttc
gccaaggccggcggcgtcggcaaggcctcgggcgcccgtccggaagagcgcgtgccgatg
acccgcgtgcgcaagaccattgccaagcgcctgatggagtccaagaactccaccgcgatg
ctgaccaccttcaacgaggtcaacctcgccaaggtgtcggccgcacgcaaggaactgcag
gacgagttccagaaggcacacggcatcaagctcggtttcatgagcttcttcgtcaaggcc
gccgccaacgcgctgcagcgcttcccgctggtcaacgcctcgatcgacggcgacgacatc
atctatcacggctacagcgacatctcgatcgcggtgtcgaccgacaagggcctggtcacg
ccggtgctgcgtaacgtcgagcgccagtcgttcgccgatgtcgagcaaggcattgccgac
tacgccgccaaggcgcgcgccggcaagctgggcctggacgaccttcagggtggcaccttc
accatcaccaacggcggcaccttcggctcgctgctgtccacgccgatcatcaacccgccg
cagagcgccatcctgggcatgcacgcgatcaaggaacgtccgatcgccgagaacggccag
gtcgtgatcgccccgatgatgtacctggcgctgtcctatgaccaccgcatcatcgacggc
aaggattcggtgcagttcctggtcgacatcaagaatcagctggaaaacccgggccgcatg
ctgttcggtctgtga

DBGET integrated database retrieval system