KEGG   Xanthomonas campestris pv. vesicatoria: XCV2089Help
Entry
XCV2089           CDS       T00288                                 

Definition
(GenBank) putative siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00860  Porphyrin and chlorophyll metabolism
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
Module
xcv_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XCV2089
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     XCV2089
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     XCV2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 CysG_dimeriser TP_methylase Sirohm_synth_M
Motif
Other DBs
NCBI-ProteinID: CAJ23766
UniProt: Q3BTU3
Position
complement(2381100..2382077)
Genome map
AA seq 325 aa AA seqDB search
MPLFPLFANLQGRAVLVIGGGEVATRKVLALLKAQAHIRLYAHALSPELAQLMQAGRFEQ
MTGEFDPAWIDTVWLVVAATDDVDLNQRVAAAAGARQRLVNVVDDAELSTYQVPAIVDRD
PLVIAISSAGAAPMLARRLRERLERELHASVGTLAALFARHRERIRQQLPDMNRRRRWFD
QVIDGKVPQLLQAGDTVAAEAAFAAALDAVDSVPARGSVQWVGAGPGDPGLLTLNALRAL
NLADVLLLASDVPAAVVELARRDAQRRAWPETPGAQQAAVVELVGAGLQVVVLRMGSGDA
IPAELDAALHAQGILSVRVPGLPLR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgttcccgttgttcgccaacctgcaggggcgcgctgtgctggtgatcggtggc
ggcgaagtcgctacacgcaaggtgctggcgctgctgaaggcgcaggcgcacatccggctg
tatgcgcatgcgctttcgcccgaacttgcccagttgatgcaggccgggcgctttgagcaa
atgacaggcgagttcgatcctgcctggatcgacaccgtgtggctggtcgtcgccgccacc
gatgatgtggatctgaatcaacgtgtggccgcagcggccggcgcacgccagcgtctggtc
aatgtcgtggacgatgccgagctctccacctaccaggtgccggccattgtcgaccgcgat
ccgctggtgattgcgatttcgtcggcgggcgcggcgccgatgctggcgcgccgactgcgc
gagcgactggagcgcgaactgcatgcgtcggtgggtacgctggcggccttgttcgcccgg
caccgcgagcgcattcgtcagcagttgccggacatgaaccggcggcgccgctggttcgac
caggtgatcgacgggaaggtgccgcaattgctgcaggccggcgataccgtcgccgccgaa
gccgcctttgccgctgcgttggacgcggtggacagcgttccggcgcgcggcagcgtgcaa
tgggtcggtgccggcccgggcgatcccggcctgctcacgctcaatgccttgcgtgccctg
aacctggccgacgtgctgctgctggcgtcggacgtgcccgccgcggtggtggaactggcg
cgccgggacgcgcaacggcgcgcctggccggagacgccgggcgcgcagcaggccgccgta
gtggagttggtcggcgccgggctgcaggtcgtggtcctgcgcatgggcagcggcgatgcc
atcccggcggagctggacgccgcgctgcacgcgcagggcatcctgtcggtgcgggttccg
ggtttgccgctccgctag

DBGET integrated database retrieval system