KEGG   Xanthomonas campestris pv. vesicatoria: XCV2363Help
Entry
XCV2363           CDS       T00288                                 

Definition
(GenBank) putative secreted protein
Organism
xcv  Xanthomonas campestris pv. vesicatoria
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraU
Motif
Other DBs
NCBI-ProteinID: CAJ24040
UniProt: Q3BT19
Position
complement(2692630..2693577)
Genome map
AA seq 315 aa AA seqDB search
MTRPFDLLRRLRAGVASVLLLSATGSYALDTATVVGSVASPDCLEYRVVGICYWLYCTWT
GCTVRTSIKVRHYIPDAVVSSYSNTGENPWVEVRAMSTPNPSAQAGGDGTTNEDHENDLA
KFKNADVIGHPGVEVFNQFVSSSGYFCEGAGTAFMPYLLSTLDTLAWRYNVPEMAYPEAL
VPGMREVGARTTMNLWGNVYPRGGFLHQTDDHKAGAVVAQRAGDVVTRRGQIHVYQPLLA
DSRPGYWPAGALVEGDASTGKWQELTPVLSSSCTVFPRNDFLTQAQQGDYAWALWRPYAC
CERKGQVFLGSVDFN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgaccattcgacctgttgaggcgcctgcgcgctggcgtggcgtccgtgctgcta
ctcagtgccaccggaagctacgccctcgacaccgccaccgtcgtcggctcggtggcatcg
cccgactgcctcgaataccgggtcgtcggcatctgctactggctctactgcacttggacc
ggctgcaccgtgcgcacgtctatcaaggttcgccactacatccccgatgccgtcgtctcc
agctacagcaataccggcgagaacccctgggtcgaagtccgggcgatgagcacgcccaac
ccatccgcccaagcaggcggcgacggaaccacgaacgaagaccacgagaacgacctcgcc
aagttcaagaacgccgacgtgatcggccaccctggcgtcgaggtgttcaaccagttcgtc
tcgtcgtcgggctacttctgcgagggcgcgggtacggcgttcatgccgtacttgctcagc
acgctggatacgctggcctggcgctacaacgtgcccgagatggcctacccggaagcgctg
gttccaggcatgcgcgaggtcggcgcacgcaccacgatgaacctctggggcaacgtgtat
ccccgtggcggcttcctgcaccagaccgacgaccacaaagctggtgccgtggtggcccaa
cgtgcaggtgatgttgtcacgcgccgcgggcagatccacgtctatcagccgctgctcgcc
gattcgcggcccggctactggcctgccggcgcgctggtggagggcgacgcatcgaccggg
aagtggcaggaactcacgcccgttctgtcctcgtcctgcacggttttcccgcgtaacgat
ttcctgacccaggcccagcaaggcgactacgcctgggcattgtggcggccctatgcctgc
tgcgaacgcaagggccaggtcttcctcggcagcgtcgatttcaactga

DBGET integrated database retrieval system