KEGG   Xanthomonas campestris pv. vesicatoria: XCV2368
Entry
XCV2368           CDS       T00288                                 
Name
(GenBank) putative secreted protein
Organism
xcv  Xanthomonas campestris pv. vesicatoria
SSDB
Other DBs
NCBI-ProteinID: CAJ24045
UniProt: Q3BT14
Position
complement(2698525..2698965)
AA seq 146 aa
MLSNLNRGLALALAVAVLGGCATSKEKLLPHGDSTMMDIWQQNAGDGGGSAGQAARRQLL
DARQSLRRPLTEADVQAAPAEQTRYTRTARNEVYRQFHRLPNPDLVMYVYPHLAGSDPVP
VPGYTTVFPLYQRVQYAMPGERVEEY
NT seq 441 nt   +upstreamnt  +downstreamnt
atgctctcgaacttgaataggggcctggcgctggccctcgccgtcgcggtgctcggcggc
tgcgccaccagcaaggaaaagctgctgccccacggcgacagcacgatgatggacatctgg
cagcagaacgccggcgacggcggcgggagcgccggccaggcggcacgccggcagttgctc
gatgcccgccagagcctgcgccggccgctgaccgaggccgacgtgcaggccgcgcccgcc
gagcagacgcgctacacgcgcaccgcgcgcaacgaggtctatcgccagttccaccggctg
ccgaatcccgatctcgtcatgtacgtgtatccgcacctggcgggctcggaccctgtacct
gtgccgggctacacgacggtcttccccctctatcagcgcgtgcagtacgccatgccgggc
gagcgcgtggaggaatactga

DBGET integrated database retrieval system