KEGG   Xanthomonas campestris pv. vesicatoria: XCV2371
Entry
XCV2371           CDS       T00288                                 
Name
(GenBank) putative secreted protein
Organism
xcv  Xanthomonas campestris pv. vesicatoria
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: CAJ24048
UniProt: Q3BT11
Position
complement(2701277..2701969)
AA seq 230 aa
MSRFKNEISHLQAHIKTLRLGAGALVVVALVMGAGWWSAPRDLTIHVPPDLRSGSTRKWW
EVPPESVYAFTFYVFQTLNRWPTNGEEDYARNLHTLSPYLTPSCQAFLRADYDYRRSTGE
LRQRVRGIYEIPGRGYGDDPTARVRVVSDRDWVVTLDITADEYYGAEQVKRALVRYPVKV
TRVDVDPARNPFGLALDCYDGAPQRISAPEPTRPAPGGLSPQAPQGENTP
NT seq 693 nt   +upstreamnt  +downstreamnt
atgagccgtttcaagaacgaaatttcgcacctgcaggcgcacatcaagacgctccgcctg
ggcgctggggccctggtcgtcgtcgccctggtcatgggcgccggctggtggagcgccccg
cgcgacctgaccatccacgtcccgcccgacctgcgctccggcagtacccgcaaatggtgg
gaggtaccgcccgaatcggtctatgcgttcacgttctacgtgttccagacgctgaaccgc
tggccgacgaatggcgaagaggactacgcacgcaacctccatacgctctcgccgtacctc
accccgtcctgccaggccttcctgcgcgcggactatgactaccgccgcagcacgggcgag
ctgcgccagcgcgtgcgcggcatctacgaaatccccggccgcggctacggcgacgacccc
acggcgcgcgtgcgcgtggtctccgaccgcgactgggtggtgacgctcgacatcaccgcc
gacgagtactacggcgccgagcaggtcaagcgcgctctcgtgcgctacccggtgaaagtc
acgcgggtggacgtcgatcccgcccgcaacccgttcggcctggcgctggactgctacgac
ggtgcgccccagcgcatcagcgccccggagccgacgcgcccggcgcctggcggcctgtct
ccgcaagcgccccaaggagaaaacaccccatga

DBGET integrated database retrieval system