KEGG   Xanthomonas campestris pv. vesicatoria: XCV2377
Entry
XCV2377           CDS       T00288                                 
Name
(GenBank) putative membrane protein
Organism
xcv  Xanthomonas campestris pv. vesicatoria
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 TniB AAA_22
Other DBs
NCBI-ProteinID: CAJ24054
UniProt: Q3BT05
Position
complement(2704206..2706398)
AA seq 730 aa
MSGKQPVEVLLRPAVELYTVAACAGAAFLSLVAPWSLALSPAMGVGSALAFGAYGAIRYR
DARVILRYRRNIRRLPRYVMTSRDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYA
EPTPAYRLARRLEERLEFAPFPLSRLPALTGWDVPFNPVRPLPPVGGLPRLHGIEPDEVD
VSLPLGERVGHSLVLGTTRVGKTRLAELFVTQDIRRKNAADEHEVVIVIDPKGDADLLKR
MYVEAKRAGREREFYVFHLGWPDISARYNAVGRFGRISEVATRVAGQLSGEGNSAAFREF
AWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKAWEVIVQIEAK
LNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLTDPRPIFDWMQIIRKRAIVYVGLDALSDAEVAAAVGNSMFSD
LVSVAGHIYKHGIDDGLPGASAGARVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAY
TQTLSDIEARIGNRAKAGQVIGNFNNLFMLRVREAATAELLTRQLPKVEVYTTTIVSGAT
DSSDIRGATDFTSNTQDRISMSSVPMIEPSHVVGLPKGQCFALLQGGQLWKVRMPLPAPD
PDEVMPADLQQLAGYMRQSYSEATQWWEFTSSPALQETGLPDDLLDDAAPAEPPAVATVS
DDGAGNEASQ
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgtcggggaaacagccagttgaggtactgcttcgcccagcggtggagctatataccgtc
gcggcgtgtgcaggcgccgcgtttctgtccctggtggcaccctggtcgctcgcgctgagc
cccgccatgggcgtcggcagcgcgctggcgttcggggcctacggcgccatccgctaccgc
gatgcccgggtcatcctgcgctaccggcgcaacatccgccgcctgccgcgctacgtgatg
accagcagggacgtgccggtcagccagcagcggctgttcgtggggcgtgggttcttgtgg
gagcagaagcatacccataggctcatgcagacgtaccggccggagttccgccgctacgcc
gagccgacaccggcctaccggctggcgcgtcgcctggaagaacggctggagttcgccccg
ttcccgctgtcccggctgcctgcgctcaccggctgggacgtgcctttcaacccggtgcgg
ccgctgccgcctgttggcggcctgccgcgcctgcacggcatcgaacccgacgaggtggac
gtcagcctgccgctgggcgagcgcgtcgggcactcgctggtgctgggcactacgcgcgta
ggcaagacgcgactggccgagttgttcgtgacccaggacatccggcgcaagaacgccgcg
gacgagcacgaggtcgtgatcgtcatcgatcccaagggggacgcggacctgctcaagcgg
atgtacgtcgaggccaagcgagcgggccgcgagcgcgagttctacgtcttccatttgggc
tggccggacatttccgcgcgctacaacgccgtgggccgcttcggccgcatcagcgaggtg
gccacccgcgtcgcggggcagctttccggcgaaggcaactcagccgccttccgagagttt
gcgtggcgattcgtcaacatcatcgcccgcgccctggtggagctgggacagcggcccgac
tacatgctgatccagcggcacgtcatcaacatcgacgcgctgttcatcgagtacgcccag
cactacttcgccaagacggagcccaaggcctgggaggtgatcgtccagatcgaggccaag
ctcaacgagaagaacatcccgcgcaacatgatcgggcgcgagaagcgcgtggtggcgctg
gagcagtacctctcgcaggcgcgcaactacgacccggtgctggatggcctgcgctcggcg
gttcgctacgacaagacgtacttcgacaagatcgtcgcatcgctgcttccgctgctggag
aagctgacaagcggcaagatcgcccagctcctggccccgaactattccgacctgaccgac
ccgcgcccgatcttcgactggatgcagatcatccgtaagagggccatcgtctatgtgggc
ctggacgcgctgtccgacgccgaggtcgccgcagcggtgggcaactcgatgttcagcgat
ctcgtgtcggtcgccgggcacatctacaagcacgggatcgacgatggcctgccgggagca
tcggccggtgcgcgcgtgccgatcaatgtccatgccgacgagttcaacgagttgatgggc
gacgagttcatcccgctcatcaacaaaggcggcggtgccggcctgcaagtcacggcctac
acgcagaccctctcggacatcgaggcccgcatcggcaaccgcgccaaggccggtcaggtg
atcggaaatttcaacaatttgttcatgctgagggtcagggaggccgcgacggccgaactc
ctaacgaggcagttgccgaaggtcgaggtctatacgaccaccatcgtgagcggcgcgacc
gacagctcggacattcgcggggcgacggatttcacgtcgaacacccaggaccgcatcagc
atgtccagcgtgccgatgatcgagccgtcgcatgtcgtcggcctgcccaagggccagtgc
ttcgcgctgctgcagggcggccagctttggaaagtgcgcatgccgctgccggcgccggac
ccggacgaggtgatgccggcagacttgcagcaactggccgggtacatgcgccagagctac
agcgaagcgacgcagtggtgggagttcaccagctccccggccttgcaggagacaggcctg
cccgacgacctgctggatgacgccgctccggccgaacctcccgcggtggccaccgtcagc
gacgatggcgccggcaacgaggcctcgcaatga

DBGET integrated database retrieval system