KEGG   Xanthomonas campestris pv. vesicatoria: XCV2379Help
Entry
XCV2379           CDS       T00288                                 

Definition
(GenBank) putative lytic transglycosylase precursor
Organism
xcv  Xanthomonas campestris pv. vesicatoria
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT Glucosaminidase
Motif
Other DBs
NCBI-ProteinID: CAJ24056
UniProt: Q3BT03
Position
complement(2706939..2707529)
Genome map
AA seq 196 aa AA seqDB search
MAAPAVAVPLRALMLVAGLCACVAQAQEVPPPAYQLAAQRAGIPSTVLYAVALQESGIRR
NGRTVPWPWSLNVAGQSRRFATRADACAGLQQAMRSTPHTRIDAGLGQINLGYHQRRYAN
ACDLLDPYRNLATAAEILKEQHAPGEDWLLAIGRYHRPAGGEPAARYRRSVSRHLARVQG
ARPAAAALAARQETSP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgccagccgtagccgtccccctgcgcgcactgatgctcgtcgctggcttgtgc
gcctgcgtagcccaggcccaggaggttccgccaccggcctaccagcttgccgcccagcga
gcaggcatcccttcgacggtgctctacgccgtggccttgcaggagagcggcatccgccgc
aacggtcgcaccgtcccgtggccgtggtccctcaacgtcgccggccagtcgcgccgcttt
gccacgcgcgccgatgcctgcgcaggtctccagcaggcgatgcgctccacgccgcacacg
cgcatcgacgcgggcctgggccagatcaacctcggctatcaccagcggcgctacgccaat
gcgtgcgacttgctcgacccgtaccgcaacctcgccaccgctgccgagatcctgaaggaa
cagcacgcccccggcgaggactggttgctggcgatcggccgctaccaccgccccgcgggc
ggtgaacccgctgcccgctatcgccgtagcgtgtcccgccaccttgcccgtgtgcagggc
gcgcgcccagccgccgcggccctcgccgcgcgccaggagacatccccatga

DBGET integrated database retrieval system