KEGG   Xanthomonas campestris pv. vesicatoria: XCV2380
Entry
XCV2380           CDS       T00288                                 
Name
(GenBank) putative secreted protein
Organism
xcv  Xanthomonas campestris pv. vesicatoria
SSDB
Motif
Pfam: Glutaredoxin Glrx-like
Other DBs
NCBI-ProteinID: CAJ24057
UniProt: Q3BT02
Position
complement(2707511..2708236)
AA seq 241 aa
MKPSIILSAFLLASAQWPAWAQQPTSAPARNAQSQERPLATRALDDRVASDWGLQPQEWA
RYRELMDGPLGIYSPNLDPLSALGIEARTDEERRRYAELQVQVEARRVEKLLAYQRAYDE
AWQRLNPGMQRVNLPDDKPAAGATRGSGRTAVFVKDGCAACDQLVQRLQSAGTEFDLYMV
GSRQDDGRIRDWAKRANVDPARVRGGTITLNHDGGRWLSLGLPGDLPAVVREVNGQWQRQ
P
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaagccgtcgatcatcctctccgcgttcctgctggcctcggcccagtggcccgcctgg
gcccagcagcccacctccgctcccgcccgcaatgcgcagagccaggagcgcccgctggcc
acccgcgccctggacgaccgggtggcaagcgactgggggctgcaaccacaggaatgggcg
cgctaccgcgaactgatggacgggcccttgggcatctactcgcccaatctggacccgctg
tcggccctgggcatcgaggcccgcaccgatgaagaacggcggcgctatgccgaactgcaa
gtgcaagtcgaagcgcgccgcgtggagaagctgctcgcctatcagcgtgcctacgacgag
gcctggcagcgcttgaaccccggcatgcaacgggtaaacctgcctgacgacaagccagcg
gccggagccacgcgcggctcgggtcgcacggcggtgttcgtgaaggacggttgcgcggcc
tgcgaccagctcgtgcagcgtctgcaatcggcgggcaccgagttcgacctgtacatggtg
ggtagccgccaggacgacgggcgcatccgcgattgggccaagcgcgcgaacgtcgatcct
gcgcgcgtgcgcggcggcaccatcacgctgaaccatgacggcggccgctggctgtcgctg
ggcctgcccggcgacttgcccgcggtcgtgcgcgaggtgaacggccaatggcagcgccag
ccgtag

DBGET integrated database retrieval system