KEGG   Xanthomonas campestris pv. vesicatoria: XCV2382Help
Entry
XCV2382           CDS       T00288                                 

Definition
(GenBank) putative secreted protein
Organism
xcv  Xanthomonas campestris pv. vesicatoria
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAJ24059
UniProt: Q3BT00
Position
complement(2708872..2709471)
Genome map
AA seq 199 aa AA seqDB search
MCPSPPWFHHPERRLLAGFLGLLWSVLAGGCATASAPVAPDTIEEVSAAPVPEAPEYIPV
VRYDRYTLVELAPTAAQRDLLLQTIDVSMPEDARATVGDGLRHVLKRSGYGLCRTAHAVI
ELYTLPLPAAHLHLGPMTLRDALLTLAGPAWELHADDRARQICFERPGDSMTADNVPAPP
ATEAVQTFPLVPEASEGQP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtgcccctctcccccctggtttcaccatcccgaacgccgcctgctggcgggttttctc
ggcctgctttggtcggtgctggctggcggctgcgcgacggcgagcgcgccggtcgcgccc
gacaccatcgaggaagtctcggccgcgcccgtacccgaggcgcccgagtacatccccgtc
gtgcgctacgaccgctacaccctcgtggaactggcaccaacagcagcgcagcgcgacctg
ctgttgcagaccatcgacgtgtcgatgcccgaggatgcacgcgccacggtcggcgacggg
ctacggcatgtgctcaagcgcagcggttacggcttgtgccggacggcgcacgcggtgatc
gagctgtacaccctgccgctgccggcggcgcacctgcacctcggccccatgaccctgcgc
gatgcgctgctcaccctggctggtccggcctgggaactgcacgcggatgaccgcgcgcgg
caaatctgcttcgagcggcccggcgacagcatgaccgccgacaacgtacccgcgccgccc
gccaccgaggcggtgcagacgttcccgctggtgcccgaggcatcggaaggtcagccataa

DBGET integrated database retrieval system