KEGG   Xanthomonas campestris pv. vesicatoria: XCV2607Help
Entry
XCV2607           CDS       T00288                                 

Gene name
xseA
Definition
(GenBank) exodeoxyribonuclease VII large subunit
  KO
K03601  exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    XCV2607 (xseA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xcv03400]
    XCV2607 (xseA)
Enzymes [BR:xcv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     XCV2607 (xseA)
DNA repair and recombination proteins [BR:xcv03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     XCV2607 (xseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_VII_L tRNA_anti_2 tRNA_anti-codon CdvA
Motif
Other DBs
NCBI-ProteinID: CAJ24284
UniProt: Q3BSC5
Position
2938873..2940210
Genome map
AA seq 445 aa AA seqDB search
MADRNDQILTPSQLNSLARDLLEGSFPLVWVEAELSSVTRPASGHLYFTLKDARAQIRCA
MFKPKSTWLKFQPREGLRVLARGRLTLYEARGDYQLVLDHMEEAGEGALRRAFDELRARL
AAEGLFDAERKQALPAHVQRLAVITSPSGAAVRDVLSVLARRFPLLEVDLLPSLVQGDSA
AAQITSLLQRADASGRYDVILITRGGGSLEDLWAFNDERLARAIAAAQTPVVSAVGHETD
FSLSDFVADVRAPTPSVAAELLVPDQRELVARVRRAQARMTQLQQHALGNAMQRADRLAL
RLRAQSPQARLQLLHRRQQDAGRQLRARMMQVLERLQARVQQGQAQLQAHNPQRQLAGLQ
QRLRALHPQAAMQRRLQHDQLQLRSIARSLEAVSPLATVARGYAIVTRPADGSVVRSAAE
VVTGERLRAQLADGSIQVRVESGES
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccgcaacgatcagatcctcactcccagccagctcaattcactggcgcgcgac
ctgctggaaggcagcttcccgctggtgtgggtggaagccgaactgagcagcgtcacccgt
cccgcgtcgggacatctgtatttcacactcaaggatgcgcgcgcgcagatccgctgcgcg
atgttcaagcccaagagcacctggctgaaatttcagccgcgcgaaggcctgcgcgtgctc
gcgcgcgggcgcctgaccctgtacgaagcacgcggcgactatcagctggtgctcgaccat
atggaagaagccggcgaaggcgccctgcgtcgcgccttcgacgaactgcgcgcgcgtctt
gccgccgaaggcctgttcgatgccgagcgcaagcaggcactgcctgcgcatgtgcagcgg
ctggcggtgatcacctcgcccagcggcgcggcggtgcgcgatgtgctcagcgtgctggcg
cggcgttttccgctgctcgaagtggatctactgccctcgctggtgcaaggcgacagcgct
gccgcacagatcacctcactgctgcaacgcgccgatgcttccgggcgctacgacgtcatc
ctgatcacccgcggtggcggctcgctggaagatctgtgggccttcaacgacgaacgcctg
gcgcgcgcgatcgccgccgcgcagacgccggtggtgtctgcagtcggccacgagaccgac
ttcagcctcagcgatttcgtggccgacgtgcgtgcgcccacgccctcggtcgcggccgaa
ttgctggtgcccgatcaacgcgagctggtcgcgcgcgtgcggcgtgcgcaggcacgcatg
acccaactgcagcaacacgccttgggcaatgccatgcaacgcgcagacagactggcactg
cgcctgcgtgcgcagagcccgcaggcgcgcctgcaactgctccatcgccgccagcaagac
gccggtcgccagctgcgtgcgcgcatgatgcaggtgctcgaacgcttgcaggcgcgtgtg
cagcaggggcaagcgcagctgcaagcacacaacccgcaacgccagctggccggcttgcag
caacgcctgcgggcactgcacccgcaggcggcgatgcaacgccgcctgcagcatgatcag
ctgcaactgcgcagcattgcacgctcgctggaagcggtcagcccgctggccacagtcgcg
cgcggctacgccatcgtgacccgccctgccgacggcagcgtggtgcgcagcgccgccgag
gtggtcacgggcgaacgcctgcgcgcgcagctggccgatggcagcatccaggtgcgtgtg
gagtctggcgaaagctga

DBGET integrated database retrieval system