KEGG   Xanthomonas campestris pv. vesicatoria: XCV3402Help
Entry
XCV3402           CDS       T00288                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00564  Glycerophospholipid metabolism
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
Module
xcv_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    XCV3402
Enzymes [BR:xcv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     XCV3402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PSDC PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CAJ25133
UniProt: Q3BQ30
Position
3890364..3891194
Genome map
AA seq 276 aa AA seqDB search
MTSVTGPLLDAHYQRSFGVLAGYLPEDRSGLAAWHAVIREKAAQLRNDQGPGYANQAVQD
LANLIDTNGIVRMYVAEAIDQTSAFMKNIKNIQDMLEQLDFICTTAPEYNVNKKLRVLFP
MSALFVDMMATPAGKALFRLEPFNEALRAILQTWAAYLDSQASCWVLNRDPNIGWLGTAA
IAEFKLADFVIDWDAEYGGFQSYNDFFHREIQASCRPLAGEGDANIITSPNDGTVYRIAT
DVQQSAVFWIKEQSYSLQDMLANPDAALLQRFVEAR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgttaccggaccattgttggacgcacactatcaacgcagctttggcgtgctg
gccggatatcttccggaagatcgcagcgggcttgccgcgtggcatgccgtcattcgtgag
aaagctgcccaactccgcaacgatcaaggacccggctacgccaaccaggcggtgcaggat
ctggctaacctgatcgataccaatggcatcgtgcgcatgtatgtcgccgaggccatcgac
cagaccagcgctttcatgaaaaacatcaagaacatccaggacatgctggagcaactcgat
ttcatctgcacgactgcgcccgaatacaacgtcaacaagaagctgcgggtgctttttccg
atgtccgcactgtttgtcgacatgatggcgacgcctgccggcaaggcgctgttccgtctt
gagccgttcaatgaagcgctgagggccatcctgcagacatgggcggcgtatctcgacagc
caggccagctgctgggtgcttaatcgagatcccaacatcggatggctgggcaccgccgcc
atcgccgaattcaagctcgccgatttcgtcatcgattgggatgccgagtatggcggcttt
cagtcctacaacgacttctttcatcgcgaaattcaggccagttgtcggcccctcgcagga
gaaggtgatgcaaatatcatcacctcgcccaacgacggcacggtgtatcgcatcgcaacc
gatgtgcaacaaagcgccgtgttctggatcaaggagcagagctactcgctacaagacatg
ctcgccaatccggacgccgcgctgttgcagcgctttgtggaggcacggtag

DBGET integrated database retrieval system