KEGG   Xanthomonas campestris pv. vesicatoria: XCV3849Help
Entry
XCV3849           CDS       T00288                                 

Gene name
cheR4
Definition
(GenBank) methylase of chemotaxis methyl-accepting proteins
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv02020  Two-component system
xcv02030  Bacterial chemotaxis
Module
xcv_M00506  CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XCV3849 (cheR4)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    XCV3849 (cheR4)
Enzymes [BR:xcv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     XCV3849 (cheR4)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     XCV3849 (cheR4)
Two-component system [BR:xcv02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   XCV3849 (cheR4)
Bacterial motility proteins [BR:xcv02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XCV3849 (cheR4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR HWE_HK PAS_10 CheB_methylest PAS_3 CheR_N PAS_4 IncA CENP-F_leu_zip WEMBL PAS Wtap DUF1664 HisKA_2 Spc7 Exonuc_VII_L HATPase_c_2 GAS Fez1 TPR_MLP1_2 Tropomyosin Golgin_A5 DUF3584 DUF4071 RPW8 MCC-bdg_PDZ Sec8_exocyst FapA Atg14 LMBR1 HAUS-augmin3 MCRA NBP1 DUF713 DUF745 DUF3538 KASH_CCD AAA_23 TMF_TATA_bd Mnd1 LXG Com_YlbF HMMR_N HOOK APG6 HemX IFT57
Motif
Other DBs
NCBI-ProteinID: CAJ25580
UniProt: Q3BNT3
Position
complement(4431898..4435437)
Genome map
AA seq 1179 aa AA seqDB search
MTDDETSNNDIATDANTQPPLFVLGVGAAGMDADRLAELLDAIAGASNLAIMLLLRDRQL
LDEARLRELLGSQATLLSVPSDGDRLQPGRFYLPPADTVVTLEEGRIRLRALPGGESDHG
LIDSFFVSMAHDQDGNVIGLIMGRFDGDGTLGTAAIRECGGLALAVDDAALHGLDLRSAS
NPAAITDDILPLPQIAARIAAHMQRHHGYGHPVPTGVRNGSESDKLSQVAAILRNTTGHD
FHGYKRATFLRRVQRRMQVAQVETLEQYLEVLRNRFDEPLQLFNDLLIGVTKFFRDRREF
EFLEQQVIPRLFQGKHTGDSLRIWVLGCSTGEEAYSLAMLLREHAETLDTAPRIQIFASD
IDGRALATARVGRYASSIVGEVAPERLRRWFVKEGDTYVVSKELRELCVFSQHSIVKDPP
FSRLDLVSCRNLLIYLDAELQNRVVPIFHFAIRPGGYLFLGNAENVSRHAQLFTPVERSF
RVFQRIDAQSNVHATFPTVQPAAVARVPTPPQRQRTSSNALVRAGERIADRYAPAYAVLD
EQFEVLHFSSQAERFIRPGGGTPSLNLLNLIHRDLRLDLRSALSRAERERAPVHVRGVQV
HEDAATWAVNLFVEPTADSDVPRGYVVLFQEVEAREPVELPAPHDSVHDDGHVQVLENEL
RITRERLQSMIEELESTNEELKSSNEEYQSLNEELQSANEELETSKEELQSVNEEVTTVN
GELAHRVQELAHANSDLKNLLESTQIATVFLDNELRVTNFTPAVTDLPLVESDIQRPISH
IKLHVDYDELQDDARRVIRTLAVLDREVENPTTHARYMVRVLPYRTVDNFIGGAVLTFMD
VTPLTRAERALRSSEQRLRTLMEGIPQLVWRSLDGGRWTWSSPQWSSYTGQGDAESLELG
WLQAVHPDDRQPTMNAWLGSASSGGLDIEHRLFNAAEQGYRWFHTRSAPVRDERGQVLEW
LGTSTESDNLRRLQEEQRVLVAELQHRTRNLITVVQSVAKQTVQASQSMPEFAAKFEDRL
AALSRVQGLLSQSDNMPTTIGALLRMELDALGAEPDQRRIVVEGPNVALRKSAVQTLALA
LHELATNALKHGALAVETGTLSIRWEVVSGSDTPARLKLLWIEEGASQQLRGDRDEAGGF
GRRLIENALPYSHGAQTRYELSDTRLECEIQLPLNPVNG
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacgaaacttccaacaacgacatcgctacggatgcgaacacgcagccgccc
ttgttcgtgcttggcgtgggcgccgccggtatggacgccgatcgcctggcagaattgctc
gatgcgattgctggcgcgtcgaatctggccatcatgctgttgttgcgcgaccgccaatta
ttggatgaggcacgcctgcgcgaactgcttggcagtcaggccaccctgctgtcggtaccc
agcgatggcgaccggctgcaaccggggcgcttctatctgccgccggccgatacggtcgtc
acgctggaggaagggcgcatccgtctgcgcgccttgcccggtggcgagagcgaccacggg
ttgatcgacagcttcttcgtctcgatggcgcacgatcaggacggcaatgtgatcggcctg
atcatggggcgcttcgacggcgacggcacgctggggaccgcggcgatccgtgagtgcggc
ggtctggcgctggccgtggacgatgccgcactgcatgggctggacctgcgcagtgccagc
aacccggccgccatcaccgacgacatcctgcccctgccacagatcgccgcgcgtatcgcc
gcgcacatgcaacgccatcacggctacggtcatccggtgccgaccggcgtgcgcaatggc
agcgagagcgacaagctcagccaggtcgccgccatcctgcgcaataccaccggccacgat
tttcatggctacaaacgcgccaccttcctgcgccgcgtgcagcggcgcatgcaggtcgcg
caggtggaaacgctggagcagtatctggaggtgttgcgcaatcgtttcgacgaaccgttg
cagctgttcaacgacctgctgatcggcgtgaccaagttctttcgcgaccgccgcgagttc
gaattcctcgagcagcaggtgattccgcgcttgttccagggcaagcacaccggcgacagc
ctgcgcatctgggtgctgggctgctccacgggcgaagaggcctattcgctggcgatgctg
ctgcgcgaacacgccgaaaccctggacaccgcgccacgcatccagatcttcgccagcgat
atcgacgggcgcgcactggccactgcacgggtggggcgctatgcctccagcatcgtcggt
gaagttgcacccgaacgactgcggcgctggttcgtcaaggaaggcgacacctatgtggtg
agcaaggagctgcgcgagctgtgcgtgttctcccagcacagcatcgtcaaggacccgccg
ttttcgcgactggacctggtttcgtgccgcaatctgctgatctatctggatgccgagttg
cagaaccgggtggtgccgatctttcatttcgccatccgtccgggcggttacctgttcctg
ggcaatgccgaaaacgtctcgcggcatgcgcaactgttcaccccggtggagcgcagcttc
cgggtcttccagcgcatcgatgcgcaaagcaacgtgcatgcgaccttcccaaccgtgcag
cccgctgcggttgccagggtgccgacaccaccgcagcggcagcgcacctccagcaatgcg
ctggtgcgtgccggcgagcgtatcgccgaccgttatgcgccggcgtatgcggtgctggac
gagcagttcgaggtgctgcacttctcgtctcaggcggagcgcttcatccgccccggcggc
ggcacgcccagtctcaacctgctcaacctgatccatcgcgatttgcgcctggatttgcgc
agcgcgctcagccgcgcagagcgcgaacgcgcgcctgtgcacgtcagaggtgtccaggtg
cacgaagatgcggcgacctgggcggtgaacctgttcgtcgagccaaccgccgattcggac
gtgccgcgcggctacgtggtgctgttccaggaagtggaagcgcgcgaaccggtggagctg
cccgccccacacgacagcgtgcacgacgatggtcatgtgcaggtgctggaaaacgagctg
cgcatcacccgcgagcgcctgcaatcgatgatcgaagagctggagagcaccaacgaggag
ctcaagtcttccaacgaggaataccagtcgctcaacgaagaactgcagagcgccaacgag
gagctggaaacctccaaggaagaactgcaatcggtcaacgaggaagtgaccaccgtcaac
ggtgagctggcccatcgcgtgcaggagctggcgcatgccaacagcgatctgaaaaacctg
ctggaaagcacccagatcgccaccgtcttcctcgacaacgaattgcgcgtcaccaacttc
accccggccgtcaccgacctgccgctggtggaaagcgacatccagcgcccgatcagccac
atcaagctgcatgtggattacgacgaactgcaggatgatgcgcggcgggtgatccgcacc
ctggcggtgctcgatcgcgaggtcgaaaaccccaccacgcatgcgcgctacatggtgcgc
gtgctgccgtatcgcaccgtggacaatttcatcggtggtgcggtgctgaccttcatggac
gtcactccgctcacgcgcgccgagcgtgcgctacgcagcagcgagcaacgcctgcgcacc
ttgatggaaggcatcccacagctggtgtggcgctcgctcgatggcggccgctggacctgg
tccagcccgcagtggtccagctacaccggccagggcgatgccgaaagcctggagctgggc
tggttgcaggcggttcacccggacgatcgccagccgaccatgaatgcctggctgggaagt
gcgtccagcggcgggctggatatcgaacaccgcctgttcaatgcggccgaacaaggttac
cgctggtttcatacgcgcagcgctccggtacgcgatgaacgcggccaggtgctggaatgg
ctgggcacctccaccgagtcggacaacctgcgccgcctgcaggaagaacagcgcgtattg
gtggccgagttgcagcaccgcacgcgcaatctgatcacggtggtgcagtcggtggccaag
cagaccgtacaggccagccagagcatgcccgagtttgcggccaagttcgaagaccggctg
gccgcgttgtcacgcgtgcaggggctgctgtcgcaatcggacaatatgcccaccaccatc
ggcgccttgctgcgcatggaactggatgcgctgggggccgagccggatcaaagacgcatc
gtggtggagggaccgaacgtggcgttgcgcaaatccgccgtacagacgctggcattggcg
ttgcacgaattggccaccaacgcgctcaagcatggcgcgctggcggtggagaccggcacc
ttgtcgatccgttgggaggtcgtctccggcagcgatacgcctgcgcgcctcaagctgttg
tggatcgaagaaggcgccagccagcagctgcgcggcgaccgtgatgaggccggcggcttc
gggcgccggctgatcgaaaatgccttgccctatagccatggcgcgcagacgcgctacgag
ctcagcgacacgcgcctggaatgcgagatccagttgccgctcaatccggtgaacgggtga

DBGET integrated database retrieval system