KEGG   Xanthomonas campestris pv. vesicatoria: XCV4214
Entry
XCV4214           CDS       T00288                                 

Definition
(GenBank) putative secreted protein
  KO
K11894  type VI secretion system protein ImpI
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xcv02044]
    XCV4214
Secretion system [BR:xcv02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   XCV4214
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: CAJ25945
UniProt: Q3BMR8
Position
complement(4839002..4840333)
AA seq 443 aa
MSSSQLILTVSGAQAAQFGASAQKRFAGTGGSIGRSDESDWVLAAPGVSRTHAVVRFLNG
MYFIEDRSTNGMSLNGTALTRADPSALSDGDRLQLDSFEIQVQVQSLAAASPATPVFDPL
PDAMDDRTQVAPPPSTLRAPSATAGFELLEFGTPPAARPAVDAVLDELLLSGASRELDPL
RLLDPLPAPARDASPSAWNQSNARHDHFRPPASPDARATLPENWDMTLGDFAPPAPLPAV
SPMAAPVVSPFTSPAAPVAAAASAATTVPPELDRIFAIVVDGVMDVLRARAEIKNTFRLP
VTVIQRSENNPLKFAATAEDALQKLLAPPSASFLSGVPAFEDAFDDIRCHQMAMLAGMRA
AFDAMLFHFSPDRLEQEADAGGKRLSFGGKGRYWERYRDNFEQLRSDPDECFRRLFGDEF
ARAYEAQLARLKSARRQPAGRGI
NT seq 1332 nt   +upstreamnt  +downstreamnt
gtgtccagttcgcagttgatcctcaccgtcagcggcgcgcaggccgcgcagttcggcgcc
agcgcgcagaagcgctttgccggcaccggcggcagcatcggccgctccgacgaaagcgat
tgggtcctggccgcgcccggtgtctcgcgcacgcatgcggtggtgcgcttcctcaacggg
atgtatttcatcgaagaccgcagcaccaacggcatgtcgctcaacggcactgcgctgacg
cgtgcggacccgtccgcgctcagcgatggcgaccgcctgcagctggacagcttcgagatc
caggtgcaggtgcaatcgctggccgcagcatcgccggcaacaccggtgttcgacccgctg
ccagatgcgatggacgaccgcacccaggttgcgccaccgccgtcgacgctgcgtgccccc
tccgccacagcgggcttcgagctgctggagttcggcacgccgcctgcggcgcggcctgcg
gtggacgcagtgttggacgaattgctgctgagcggcgcatcccgcgagctggatccgttg
cgcctgctcgacccgttgcctgcgccggcgcgcgatgccagccccagcgcgtggaatcag
agcaacgcccgccacgaccatttccgtccgccggccagtcccgatgcacgtgccaccttg
ccggaaaactgggacatgacgcttggcgattttgcgccacccgcgccattgcctgcggta
tcgcccatggccgcgccggtggtttcgccattcacgtcgccggcggcgccggttgcagcc
gcagcatcggcggcaacgacggtgccgccggagctggatcgcatcttcgccatcgtggtc
gacggcgtcatggacgtgctgcgtgcacgcgcggagatcaagaacaccttccggctgccg
gtcacggtgatccagcgctcggagaacaatccgctcaagttcgccgccaccgccgaagat
gcgctgcagaagttgctcgcaccgccaagcgcgtcgtttctgtccggcgtgccagcgttc
gaagatgccttcgacgatatccgctgccatcagatggcgatgctggccggcatgcgcgca
gccttcgacgccatgctgttccacttcagcccggaccgcctggagcaggaagccgacgcc
ggcggcaagcgcctgagtttcggtggcaaggggcgttactgggagcgttaccgcgacaac
ttcgagcagctacgcagcgacccggacgaatgcttccgtcgcctgttcggcgatgagttc
gcgcgtgcctacgaagcgcaactggcgcgcctgaaatcggcacggcggcagccggcgggg
cgcgggatctag

DBGET integrated database retrieval system