KEGG   Xanthomonas campestris pv. vesicatoria: XCV4243
Entry
XCV4243           CDS       T00288                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xcv02044]
    XCV4243
Secretion system [BR:xcv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XCV4243
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAJ25974
UniProt: Q3BMN9
Position
complement(4872637..4873146)
AA seq 169 aa
MASSQKFIARNRAPRVQIEYDVEVYGAQKKVQIPFVMGVMSDLSGANAGELPSLDERKAL
EIDVDNFDSRLQSMRPRAQFKVPNTLTGEGELAVDITFESMDDFSPAAIARKVAPLAKLL
EARTQLANLDTYMDGKAGAEQLIANAIRDPALLQSLVSAAKPASEPEGA
NT seq 510 nt   +upstreamnt  +downstreamnt
atggccagcagtcagaagttcattgcccgcaatcgggcgccacgggtgcagatcgaatac
gacgtggaggtctacggcgcgcagaagaaggtgcagattccgttcgtgatgggggtgatg
tccgatctgtccggcgccaatgccggtgagctgccctcgctggatgagcgcaaggcactg
gagatcgacgtcgacaacttcgacagccgcctgcagtcgatgcggccgcgcgcgcagttc
aaggtgcccaacacgctcaccggcgaaggcgagctggcggtggatatcaccttcgaaagc
atggacgacttttcgccggccgccatcgcgcgcaaggttgcgccgctggcgaagttgctg
gaagcgcgcacgcagctggccaacctggacacctacatggacggcaaggccggtgcagag
cagctgattgccaacgccatccgcgacccggcgttgctgcagtcgctggtgtcggccgcc
aagcctgcctccgaaccggaaggagcctga

DBGET integrated database retrieval system