KEGG   Xanthomonas citri pv. citri MN10: J162_00421Help
Entry
J162_00421        CDS       T03779                                 

Definition
(GenBank) amidohydrolase, AtzE family
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
xcw  Xanthomonas citri pv. citri MN10
Pathway
xcw00970  Aminoacyl-tRNA biosynthesis
xcw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    J162_00421
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:xcw03029]
    J162_00421
Enzymes [BR:xcw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     J162_00421
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     J162_00421
Mitochondrial biogenesis [BR:xcw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    J162_00421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AJZ02595
UniProt: A0A0U5FKQ4
Position
complement(364457..365917)
Genome map
AA seq 486 aa AA seqDB search
MQLPAQWQAGVDRNTEVLRGHAQLLATFHGPPATAHEGGGPRGQIASIVSTTRSQPTLAA
RLATQTLTRINQANDRLCAITRLLPARAAADAARVQAALAGGSDGGALAGVPFVVKDLFD
VAGQVTTAGAAVRAHCPPASRDAAVVQRLGEAGAVLVGTANMDEFAYGFATVNAHYGTTA
NPHDDQHLAGGSSGGSAAAVAAGLVPFALGSDTNGSIRVPAALCGIYGLRPTHGAVPLDG
VFPFVDALDVVGPFATSVADLRCVYDVLRGQPLPSCHAGKLRVARLGGWFQRNLDPDLEA
GLQALLAACNSLASIDLPEAERARAAAFVLTAAEGGHRHRSALTAHGAQFDPATRDRLLA
GLQLPASAVADAHRFAQWFADAMHALWDQVDVLIAPATPCVAPRIDQDTIQIDGLPVSAR
ANLGIFTQPLGLAACPVLAAPLPRPGRLPLGVQLIAAPGREDRLFALAAQLERDGLLAFS
PPPEPR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcccagcgcagtggcaggccggcgtcgatcgcaataccgaagtgctgcgcggg
cacgcgcagctgctggccaccttccatgggccgcctgcaacggcgcatgagggcggcggc
ccacgcggccagatcgcctccatcgtcagcactacgcgcagccagcccacactggccgcg
cgactggccacccagacgctgacacgcatcaaccaggccaacgaccgcctgtgcgccatt
acccgcctgctgcctgcgcgtgccgcggccgatgccgcgcgcgtgcaggctgcgcttgcc
ggtggcagcgacggtggcgcgttggccggcgtgccattcgtggtcaaggacctgttcgat
gtggccgggcaggtcaccaccgccggcgccgcagtgcgtgcgcattgcccgcctgccagc
cgcgatgcagcggtggtgcaacggctcggcgaagccggcgcagtgttggtgggtaccgcc
aacatggacgaattcgcgtacggcttcgccacggtcaatgcgcattacggcacgactgcc
aatccgcacgatgaccagcacctggcgggcggctcatcgggcggctcggcggcagcggtg
gccgccgggctggtgccgttcgcgcttggctcggacaccaacggctccatccgcgtgccg
gccgcgctgtgcggcatctacggcctgcgccccacgcacggcgccgtgcccctggatggg
gtgttcccatttgtcgatgcactggatgtggtcggcccattcgccacctcggtggccgac
ctgcgctgcgtgtacgacgtactgcgtgggcagccgctgccttcgtgccatgccggcaag
ctgcgcgtcgcgcggttgggcggctggttccagcgcaatctggatccggatctggaggcc
gggctgcaggccctgctcgccgcctgcaacagccttgcgtcgatcgacctgcccgaggcc
gaacgcgcacgcgccgcggccttcgtcctgaccgctgccgaaggcgggcatcgtcaccgc
agcgcgctcaccgcgcacggcgcgcagttcgacccggccacccgcgaccgcctgcttgcc
ggcttgcagctgcctgccagcgcggtggccgatgcgcaccgcttcgcgcagtggtttgcc
gatgccatgcacgcgctgtgggaccaggtggatgtgctcatcgcgccggccactccctgc
gtggcgccacgcatcgaccaggacaccatccagatcgacggtttgcccgtctccgcgcgt
gcgaatctgggtattttcacccagccactcggcctggccgcctgcccggtgctggccgca
ccgttgccgcgtcccgggcgcctgccactgggcgtgcaactgatcgccgcgcccggccgg
gaagaccgcctgtttgcgctggccgcgcaactcgagcgcgacggcctgctcgccttcagc
ccgccgccggagccacgctga

DBGET integrated database retrieval system