KEGG   Xanthomonas citri pv. citri MN10: J162_01489Help
Entry
J162_01489        CDS       T03779                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xcw  Xanthomonas citri pv. citri MN10
Pathway
xcw00071  Fatty acid degradation
xcw00072  Synthesis and degradation of ketone bodies
xcw00280  Valine, leucine and isoleucine degradation
xcw00310  Lysine degradation
xcw00362  Benzoate degradation
xcw00380  Tryptophan metabolism
xcw00620  Pyruvate metabolism
xcw00630  Glyoxylate and dicarboxylate metabolism
xcw00640  Propanoate metabolism
xcw00650  Butanoate metabolism
xcw00900  Terpenoid backbone biosynthesis
xcw01100  Metabolic pathways
xcw01110  Biosynthesis of secondary metabolites
xcw01120  Microbial metabolism in diverse environments
xcw01130  Biosynthesis of antibiotics
xcw01200  Carbon metabolism
xcw01212  Fatty acid metabolism
xcw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    J162_01489
   00630 Glyoxylate and dicarboxylate metabolism
    J162_01489
   00640 Propanoate metabolism
    J162_01489
   00650 Butanoate metabolism
    J162_01489
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J162_01489
   00072 Synthesis and degradation of ketone bodies
    J162_01489
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    J162_01489
   00310 Lysine degradation
    J162_01489
   00380 Tryptophan metabolism
    J162_01489
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    J162_01489
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J162_01489
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J162_01489
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcw04147]
    J162_01489
Enzymes [BR:xcw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     J162_01489
Exosome [BR:xcw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J162_01489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJZ03637
UniProt: A0A0U5FBA7
Position
complement(1554563..1555738)
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAAKRTAIGSFLGQFNAVPAPTLAAAAIQGALAQSGIAPADISEVIVGCVLPAN
LGQAPARQAAIAAGIPTSTGATTINKVCGSGMKAIMLGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRTGNRYGNFQAVDHMAWDGLTNPYDGQAMGVFGEATAEKFGFSRADQDAFAI
ASVERAHAAQRSGAFADEIVPVTVATRKGDVVVDSDEQPGKSDVAKIPTLKPAFKKDGSV
TAASSSSISDGAAITVLMSADDAQRRGVTPLARIVGHVTHAQEPEWFTTAPVAAIQSLVS
KLGWRLDDVDLFEINEAFAVVAMAPIRQLGIAHDKVNVHGGACALGHPIGASGARLVVTL
VNALRSRGGKRGIATLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgttgctgccaaacgtactgccatcggctcgttcctcggccaa
ttcaatgcggtgccggcacccacgctcgccgcggctgctatccagggcgcactcgcgcaa
tcaggcatcgcgcctgccgatatttccgaagtcatcgtcggctgcgtgctgccggccaat
ctgggccaggcacctgcgcgtcaggccgcgatcgccgcaggcattcctacctcgaccggc
gccaccaccatcaacaaggtgtgcggctcgggaatgaaggcgatcatgttggggcacgac
ctgatcaaggccggctcggccagcatcgtggtggccggcggcatggagtcgatgagcaat
gccccgcatctgctgcccaactcgcgcaccggcaaccgctacggcaattttcaggcggtc
gatcacatggcctgggacggtctgaccaatccgtatgacggccaggccatgggcgtgttc
ggcgaagccactgcggagaagttcggcttcagccgcgccgaccaggatgcgttcgccatc
gcctcggtggaacgcgcgcacgcggcgcagcgcagcggcgcgtttgccgacgaaatcgtg
ccggtgacggtggccacgcgcaagggcgacgtcgtcgtcgacagcgatgagcagccgggc
aagtccgacgtggccaagattccgacgctgaagccagccttcaagaaagacggcagcgtg
accgcggccagttcctcgagtatttccgatggcgcggcaatcaccgtgctaatgagcgcg
gacgacgcgcaacgccgtggcgtgacgccgctggcacgcatcgttggccatgtcacccac
gctcaggaaccggagtggttcaccaccgcaccggtcgctgcgatccagtcgctggtcagc
aagctcggctggcgattggacgatgtggatctgttcgaaatcaacgaagccttcgccgtc
gtggcgatggcaccgatcaggcaactcggcatcgcgcacgataaggtcaatgtgcatggc
ggcgcctgcgcattgggtcatccgatcggtgcatccggcgcgcgtttggtggtgacattg
gtgaacgcgttgcgcagccgcggaggcaagcgcggaatcgccacgctgtgcatcggcggc
ggcgaagccactgccattgctatcgaattgatttaa

DBGET integrated database retrieval system