KEGG   Xanthomonas citri pv. citri MN10: J162_01853Help
Entry
J162_01853        CDS       T03779                                 

Definition
(GenBank) Phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
xcw  Xanthomonas citri pv. citri MN10
Brite
KEGG Orthology (KO) [BR:xcw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    J162_01853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HTH_IclR Pilin_N
Motif
Other DBs
NCBI-ProteinID: AJZ03997
UniProt: A0A0U5FCF4
Position
1960079..1961206
Genome map
AA seq 375 aa AA seqDB search
MLTLVLVVILAALVFEFINGFHDTANSIATVVATKVLSPGWAVMLAAGMNLIGALTGTAV
ALTIASGLLNTNVVEVTPQVILCALLGGIIWNLITWWKGLPSSSSHALIGGLCGAGLAAA
HNDWDALIWSENIGNWAKNKGLLWKVFVPMITSPIAGFVLGIVVMVLLWAIIAGMSKIGG
PIGRLARPRWVNAFFGKAQIASAAYMGYAHGHNDAQKTMGIIAMTLIGAQSAGALDDLPS
WLSFLHPGTGLAAGAGIPMWIVLTCAVVMAAGTASGGWKIIKTLGHKMVKLHPIHGFAAE
TSSATVLTVAAHFGMPVSTTHSISTAIMGVGFAKNPRSLRLGVIERIVWAWILTIPAAGG
VAYLILTLFELLGWT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgcttaccttagttctggtggtgatcctggccgcgttggtgttcgagttcatcaacggc
ttccacgacaccgccaactccatcgccaccgtggttgccaccaaggtgctctcgcccggt
tgggcggtgatgctggcagccggcatgaacctgatcggcgcgctgaccggcaccgccgtg
gcgctgacgattgcttctggcctgctcaacaccaacgtggtcgaggtcaccccgcaggtg
attttgtgcgcgctgctgggcggcatcatctggaacctgatcacctggtggaagggcctg
ccgtcgtcgtcctcgcatgccttgatcggcggcctgtgcggcgccggtctggccgcggcg
cacaacgactgggacgcgctgatctggtcggaaaacatcggcaactgggccaagaacaag
ggcctgttgtggaaggtgttcgtcccgatgatcacctcgccgatcgccggtttcgtgctc
ggtatcgtggtgatggtgctgctgtgggcgatcattgccggcatgtccaagataggcggc
ccgatcgggcggctggcgcggccgcgctgggtcaatgcgttcttcggcaaggcgcagatc
gcctcggccgcatacatgggctacgcgcacggccacaacgacgcgcagaagaccatgggc
atcatcgccatgaccctgatcggcgcgcagtcggccggcgcgctggacgacctgccgagc
tggttgtcgttcctgcatccgggcaccggccttgcggccggcgccggtatcccgatgtgg
atcgtgctcacctgcgcggtggtgatggctgcaggtaccgcgtcgggcggttggaagatc
atcaagacgctcggccacaagatggtcaagctgcatcccatccacggctttgccgcagaa
accagctcggcgacggtgctcaccgtggcggcgcatttcggcatgccggtgtccaccacg
cacagcatttccaccgccatcatgggggtgggtttcgccaagaatccgcgttcgctgcgg
ctgggcgtgatcgagcgcatcgtctgggcctggatcctgaccatcccggctgctggcggc
gtggcgtacctgatcctgacgctgttcgagctgttgggctggacctga

DBGET integrated database retrieval system