KEGG   Xanthomonas citri pv. citri MN10: J162_01867Help
Entry
J162_01867        CDS       T03779                                 

Definition
(GenBank) 5'-nucleotidase
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
xcw  Xanthomonas citri pv. citri MN10
Pathway
xcw00230  Purine metabolism
xcw00240  Pyrimidine metabolism
xcw00760  Nicotinate and nicotinamide metabolism
xcw01100  Metabolic pathways
xcw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    J162_01867
   00240 Pyrimidine metabolism
    J162_01867
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    J162_01867
Enzymes [BR:xcw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     J162_01867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE Glyco_trans_4_4 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AJZ04011
UniProt: A0A0U5FCH1
Position
1975111..1975890
Genome map
AA seq 259 aa AA seqDB search
MRVLVSNDDGVDAPGIQVLAEALRHAGHEVMVVAPDRDRSGASNSLTLDVPIRTRRIDAQ
TCAVAGTPTDCVHLALTGMLDYDPDIVVSGINNSANLGDDVIYSGTVSAAMEGRFLGLPA
VAVSLVTHNHQAHNYDTAARAAVEIVARLKADPLPADTILNVNVPDLAWSDVLGFEVTRL
GNRHRSEPCVPQRDPRGHTVYWIGPAGPEQDAGAGTDFHAVRTGHISITPIHVDLTRYQA
LDTVAGWVGGLTAALDGPA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtactggttagcaacgacgacggtgtcgacgcccccggcatccaggttttggcc
gaggcgctgcgccatgccggtcatgaagtgatggtggtcgcgcccgaccgcgaccgctcc
ggcgccagcaattcgctcacgctggatgtgccgatccgcacccgccgcatcgacgcgcag
acctgcgcagtggccggcacgcccaccgactgcgtgcatctggcgctcaccggcatgctc
gattacgacccggacatcgtggtctccggcatcaacaactcggccaatctgggcgacgac
gtgatctattcgggcaccgtgtcggccgcaatggaaggccgcttcctcggcttgccggcg
gtggcggtgtcgctggtcacgcacaaccaccaagcgcacaactacgacaccgccgcgcgc
gctgcggtggaaatcgtggcgcggctgaaggccgacccgttgcctgccgacaccatcctc
aacgtcaacgtgccggatctggcatggtcggatgtgctcggtttcgaagtcacccggctc
ggcaatcgccaccggtccgagccgtgcgtgccgcagcgcgatccgcgcggccacaccgtg
tactggatcggcccggccggtcccgagcaggatgctggcgccggtaccgatttccacgcc
gtgcgtaccggacatatctcgatcacgccgatccacgtcgatctcacccgttaccaggca
ctggacaccgttgccggctgggtgggtgggctgaccgcagcgctggacggcccggcatga

DBGET integrated database retrieval system