KEGG   Xenorhabdus doucetiae: XDD1_0167Help
Entry
XDD1_0167         CDS       T03784                                 

Gene name
manC
Definition
(GenBank) Mannose-1-phosphate guanylyltransferase 2
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
xdo  Xenorhabdus doucetiae
Pathway
xdo00051  Fructose and mannose metabolism
xdo00520  Amino sugar and nucleotide sugar metabolism
xdo01100  Metabolic pathways
xdo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    XDD1_0167 (manC)
   00520 Amino sugar and nucleotide sugar metabolism
    XDD1_0167 (manC)
Enzymes [BR:xdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     XDD1_0167 (manC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CDG15878
UniProt: A0A068QM75
Position
complement(175466..176827)
Genome map
AA seq 453 aa AA seqDB search
MKIMPKNILPIVMAGGVGSRLWPLSRTLYPKQFLKINDDLTMLEKTIDRLKNIPCSPPII
VCNDIHKDISLDCLKNNKVTKFILEPQGRNTAPAIAISALFALKHYDDPFLLVLAADHVI
DDDELFSKYIYQGIDAANNNLVTFGIEPTYAETGYGYIEQGEIISDHAYSIKKFKEKPNI
QLAQKYILDGKHLWNSGMFLFKASVLLEEIKKYAPSIFDACLRTLDSSYDKENILMLDKN
NFANCPSNSIDYAVMEKTEKGCVVPMRLGWSDIGSWKALWEISRKDSFGNAIIGDVETYD
TQNSLVYSSSRLVATLGLHDIVVVETEDAVLVSSRDKSQKVKDIVSNLQKSKRKETEKNS
EELRVWGRTTLLDQENTLIVEKIKINPNQKTILDTGTFEGKTIFTIAMGYAIISKNGDSR
KYMNGETFYLVTEEECEITNIGKEDLIIISIKF
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatgcctaaaaatattctaccaattgtaatggctggtggtgttggttcaaga
ttgtggcctttgtctaggacattatatccaaaacaattcttgaagataaatgatgatcta
actatgctagaaaagacaattgataggcttaaaaatataccctgctcaccgcctataatt
gtgtgtaacgatatacacaaagatatttcacttgattgtttaaagaataataaagtaact
aaatttatattagagcctcaaggtagaaatacagctccagcaattgctatatcagcactc
tttgctctaaaacattatgatgatccttttttactagtattagcagcagatcatgtaata
gatgatgacgaattattttctaaatacatatatcaaggaattgatgctgcaaataataat
cttgttacttttggaattgagcctacttatgcagagactggctatggatatatagaacaa
ggagaaataatttctgatcatgcatactctataaaaaaatttaaggaaaaacctaatata
caacttgctcagaaatatattttagatggtaagcacttatggaatagtggtatgttttta
tttaaggcatcagtactgctagaagagatcaaaaaatacgccccatccatttttgatgct
tgcttaagaacgttagatagttcttatgacaaagaaaatattctaatgttagataaaaac
aattttgctaattgcccttccaattctatcgattatgctgtcatggaaaaaactgaaaaa
ggttgtgttgttccgatgagattgggatggagtgatattggttcatggaaagctttatgg
gagatttcacggaaggattcctttgggaatgcaataattggagatgtagaaacatatgat
acacaaaatagtcttgtttactcttcctctagactagttgctactctaggactgcatgat
attgttgttgtagaaacggaagatgctgtattagtttcatctagggataaatcacagaag
gtgaaagatattgtttctaatctccaaaaaagcaaacgtaaagaaacagagaaaaatagt
gaagagcttagagtgtggggtagaaccacattacttgatcaggaaaacactctaattgta
gaaaaaataaagataaaccctaatcagaaaacaatattggatactggtacttttgaagga
aaaactatttttaccatagctatggggtatgcaataatcagtaagaatggtgatagtcga
aaatatatgaacggtgaaacattttatcttgtaactgaagaagaatgtgaaataactaac
attggtaaagaagatcttattattatatcaattaaattttaa

DBGET integrated database retrieval system