KEGG   Xenorhabdus doucetiae: XDD1_1158Help
Entry
XDD1_1158         CDS       T03784                                 

Gene name
gshB
Definition
(GenBank) Glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
xdo  Xenorhabdus doucetiae
Pathway
xdo00270  Cysteine and methionine metabolism
xdo00480  Glutathione metabolism
xdo01100  Metabolic pathways
Module
xdo_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:xdo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    XDD1_1158 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XDD1_1158 (gshB)
Enzymes [BR:xdo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     XDD1_1158 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD DUF4508 ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CDG16861
UniProt: A0A068QQE6
Position
complement(1142476..1143435)
Genome map
AA seq 319 aa AA seqDB search
MIKLGIVMDPISSINIKKDTSFAMLLEAQKRGWEIHYMEMNDLYLHQGEARARTRLLTVE
ENPQQWYQFGGEQEIALDTLHVILMRKDPPFDTEYIYATYILERAEVKGSLIVNKPQSLR
DCNEKLFTAWFPEWTPDTLVTRNAKNLREFHKKHGDVIFKPLDGMGGASIFRLKQDDANV
GVIIETLTEHGQRYCMAQNFLPAIKDGDKRVLVVDGEPVPYCLARIPAQGETRGNLAAGG
RGEARPLSESDWAIARAVAPVLKEKGLIFVGLDIIGDRLTEINVTSPTCVREIEAAFPDI
SITGMLMDAIEKRLEKQIA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctcggtatcgtgatggacccaatttcatccatcaacatcaagaaagacact
agttttgccatgctgctggaagcacaaaaacgcgggtgggaaatccattatatggaaatg
aatgatctctacctgcatcagggagaggctcgcgcccgcacacgtttacttacggtagaa
gaaaatccacaacagtggtatcagtttggtggtgagcaagagatcgcgctcgatactttg
cacgtgattttgatgcgcaaagatccgccttttgatactgagtacatttatgcgacctat
attctggagcgcgctgaggtcaaaggcagcctgatcgtcaataagccgcaaagcctgcgc
gactgtaacgaaaagctgtttacggcttggttcccggaatggacacccgatacactcgtc
acccgtaatgccaaaaacttacgcgaattccataaaaaacatggcgatgttatttttaag
cccctggatggcatgggaggcgcgtctatcttccgcttgaagcaagacgacgcgaatgta
ggtgtgattattgaaacgctgactgaacatggccagcgttattgcatggcacaaaatttt
ctgcccgccattaaagatggcgataagcgcgtactggttgttgatggcgaacctgtgcct
tactgccttgcccgtatccctgcccaaggggaaacccggggtaatttagccgccggcggc
cgcggggaagcacgcccgttatcagaaagtgactgggcaattgcccgcgccgtcgcccct
gtactcaaagagaaagggttaatttttgtcgggctggatatcattggcgaccggttaact
gagatcaacgtgaccagcccaacctgcgtacgtgaaatagaagcagctttcccagacatt
tccattaccggcatgctgatggatgctatcgaaaaacgattggaaaaacagatagcataa

DBGET integrated database retrieval system