KEGG   Xenorhabdus doucetiae: XDD1_1345Help
Entry
XDD1_1345         CDS       T03784                                 

Gene name
sucD
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
xdo  Xenorhabdus doucetiae
Pathway
xdo00020  Citrate cycle (TCA cycle)
xdo00640  Propanoate metabolism
xdo00660  C5-Branched dibasic acid metabolism
xdo01100  Metabolic pathways
xdo01110  Biosynthesis of secondary metabolites
xdo01120  Microbial metabolism in diverse environments
xdo01130  Biosynthesis of antibiotics
xdo01200  Carbon metabolism
Module
xdo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xdo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XDD1_1345 (sucD)
   00640 Propanoate metabolism
    XDD1_1345 (sucD)
   00660 C5-Branched dibasic acid metabolism
    XDD1_1345 (sucD)
Enzymes [BR:xdo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     XDD1_1345 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 Lysine_decarbox
Motif
Other DBs
NCBI-ProteinID: CDG17044
UniProt: A0A068QQF8
Position
1357554..1358423
Genome map
AA seq 289 aa AA seqDB search
MSILIDKNTKVICQGFTGSQGTFHSEQAIVYGTQMVGGVTPGKGGTEHLGLPVFNTVREA
VEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDQAGVRMI
GPNCPGVITPDECKIGIMPGHIHKSGKVGIVSRSGTLTYEAVKQTTDAGLGQSTCVGIGG
DPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGTAEEEAAAYIKQHVTKPVVAYIAGVTAP
KGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKVLLA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtctattttaatcgataaaaacaccaaagtgatttgccagggatttactggcagccaa
ggcacttttcactccgaacaggcgatagtctacgggactcaaatggtcggtggtgtcact
ccgggtaaagggggtactgaacatttgggtttgcctgtattcaataccgtgcgtgaagcg
gttgaagcaacgggtgcaaccgcttctgttatctacgttccggcgccattctgtaaagat
tccattctggaagcgattgatgcgggtatcaaattgatcatcacgatcacagaaggtatc
ccaacactcgatatgctgaccgttaaggtaaaactggatcaggcgggtgtacgcatgatt
ggccctaactgtccgggcgttattacacctgatgaatgtaagatcggcatcatgcctggt
cacattcacaaatcaggtaaagtgggtattgtctctcgttcaggcacattgacttatgaa
gctgttaaacagaccaccgatgctggattagggcaatctacctgtgtgggtatcggtggt
gacccgatcccaggttcaaacttcattgatattctgaaactgttccaggaagatccacag
acagaagcgattgtcatgatcggtgaaatcggtggtacagcggaagaagaagcggctgct
tatatcaaacaacatgtgactaaacctgttgttgcttatattgcaggtgtgaccgcacct
aaaggtaagcgcatgggccatgctggtgcgattatcgcaggtggtaagggaacagcagat
gaaaaatttgctgcactggaagcggcgggtgtgaagacggttcgcagtcttgctgatatt
ggcgatgctgtaaaagtgttactggcataa

DBGET integrated database retrieval system